Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3JUZ1

Protein Details
Accession E3JUZ1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-34SDGVEQERKKKDRSKKRARSPSSNVPQSLHydrophilic
NLS Segment(s)
PositionSequence
13-24RKKKDRSKKRAR
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
KEGG pgr:PGTG_01197  -  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MTEIDSDGVEQERKKKDRSKKRARSPSSNVPQSLPTSEPAGTADEGLVSTTTPADSESTDRPMCKKKAKALHRSKVDGSEDWKDKVAIAQKEIAAQAKRQNEYCGRPRPNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.6
4 0.69
5 0.78
6 0.81
7 0.82
8 0.9
9 0.93
10 0.92
11 0.91
12 0.88
13 0.88
14 0.86
15 0.82
16 0.71
17 0.62
18 0.56
19 0.48
20 0.42
21 0.32
22 0.23
23 0.19
24 0.18
25 0.17
26 0.15
27 0.14
28 0.12
29 0.11
30 0.09
31 0.07
32 0.07
33 0.07
34 0.06
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.08
44 0.09
45 0.13
46 0.15
47 0.15
48 0.18
49 0.25
50 0.3
51 0.35
52 0.39
53 0.43
54 0.52
55 0.61
56 0.68
57 0.72
58 0.76
59 0.74
60 0.74
61 0.67
62 0.63
63 0.57
64 0.48
65 0.42
66 0.41
67 0.37
68 0.34
69 0.34
70 0.28
71 0.24
72 0.27
73 0.3
74 0.25
75 0.24
76 0.26
77 0.26
78 0.28
79 0.29
80 0.3
81 0.24
82 0.25
83 0.3
84 0.34
85 0.37
86 0.37
87 0.42
88 0.44
89 0.5
90 0.56
91 0.6