Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3L8T8

Protein Details
Accession E3L8T8    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
219-242VAEEGGPKKKRKKRKQGEMLAGSNBasic
334-359PGMFCREDDYRKKKRVKIGNPAAGKTHydrophilic
NLS Segment(s)
PositionSequence
224-233GPKKKRKKRK
345-350KKKRVK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0070847  C:core mediator complex  
GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG pgr:PGTG_18976  -  
Amino Acid Sequences MQNLQPNSSALHTQDHYHHHQKQQQQQHPSQETTSTPQAGTSSTSNRQLHPNPKTLYFPVIDQGHLPAAPISGSHDLLSLFNVSSMYDWFVKPYLKPLDQTNKLGPTNNHHHHHFPNTNGDLKGKGKADIDLTGLSPAQLENLGQKRIKMEKSYGHFVADVGGRNSIKKDHQLETWISDPNFQEASVPNFLKPFSNEALSQAFTLQPGILPGFDSSVWVAEEGGPKKKRKKRKQGEMLAGSNSTLAAAHLQQPHQSPTQQTTMTTTTTTTTTSGTPTQYAVSSTTQAQPTRPLRASMVDPSSHLNSHPHSSHHPAAQASHLHLHQNQQQQHNSPGMFCREDDYRKKKRVKIGNPAAGKTSGSGSSGPNHQVALQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.42
4 0.49
5 0.55
6 0.57
7 0.63
8 0.68
9 0.72
10 0.76
11 0.77
12 0.76
13 0.76
14 0.78
15 0.77
16 0.71
17 0.63
18 0.55
19 0.49
20 0.45
21 0.44
22 0.36
23 0.3
24 0.28
25 0.26
26 0.24
27 0.25
28 0.23
29 0.24
30 0.26
31 0.36
32 0.37
33 0.38
34 0.46
35 0.51
36 0.57
37 0.57
38 0.61
39 0.55
40 0.56
41 0.59
42 0.52
43 0.49
44 0.39
45 0.34
46 0.32
47 0.3
48 0.27
49 0.23
50 0.23
51 0.2
52 0.18
53 0.18
54 0.11
55 0.1
56 0.09
57 0.09
58 0.11
59 0.12
60 0.13
61 0.13
62 0.13
63 0.13
64 0.14
65 0.15
66 0.12
67 0.09
68 0.09
69 0.09
70 0.08
71 0.08
72 0.08
73 0.1
74 0.11
75 0.11
76 0.12
77 0.14
78 0.16
79 0.16
80 0.23
81 0.27
82 0.28
83 0.3
84 0.36
85 0.44
86 0.47
87 0.51
88 0.49
89 0.48
90 0.47
91 0.5
92 0.43
93 0.41
94 0.46
95 0.5
96 0.49
97 0.45
98 0.48
99 0.48
100 0.55
101 0.51
102 0.43
103 0.43
104 0.42
105 0.43
106 0.39
107 0.36
108 0.31
109 0.29
110 0.31
111 0.24
112 0.23
113 0.2
114 0.21
115 0.21
116 0.19
117 0.19
118 0.15
119 0.14
120 0.13
121 0.12
122 0.1
123 0.08
124 0.07
125 0.06
126 0.05
127 0.05
128 0.1
129 0.14
130 0.18
131 0.18
132 0.19
133 0.23
134 0.28
135 0.31
136 0.28
137 0.29
138 0.32
139 0.37
140 0.41
141 0.38
142 0.33
143 0.3
144 0.27
145 0.25
146 0.2
147 0.16
148 0.11
149 0.13
150 0.12
151 0.13
152 0.14
153 0.14
154 0.14
155 0.19
156 0.23
157 0.22
158 0.24
159 0.27
160 0.27
161 0.27
162 0.28
163 0.24
164 0.2
165 0.21
166 0.19
167 0.18
168 0.17
169 0.14
170 0.13
171 0.11
172 0.15
173 0.16
174 0.16
175 0.14
176 0.15
177 0.15
178 0.15
179 0.15
180 0.15
181 0.12
182 0.14
183 0.13
184 0.15
185 0.16
186 0.16
187 0.15
188 0.12
189 0.1
190 0.09
191 0.09
192 0.07
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.06
207 0.07
208 0.12
209 0.14
210 0.22
211 0.26
212 0.32
213 0.42
214 0.5
215 0.6
216 0.66
217 0.75
218 0.78
219 0.85
220 0.9
221 0.9
222 0.92
223 0.88
224 0.79
225 0.69
226 0.58
227 0.46
228 0.35
229 0.25
230 0.15
231 0.08
232 0.05
233 0.05
234 0.06
235 0.11
236 0.14
237 0.14
238 0.17
239 0.19
240 0.22
241 0.23
242 0.24
243 0.21
244 0.23
245 0.27
246 0.25
247 0.24
248 0.25
249 0.25
250 0.24
251 0.22
252 0.19
253 0.15
254 0.15
255 0.16
256 0.12
257 0.11
258 0.11
259 0.14
260 0.16
261 0.16
262 0.16
263 0.15
264 0.16
265 0.15
266 0.15
267 0.15
268 0.14
269 0.15
270 0.16
271 0.2
272 0.23
273 0.24
274 0.24
275 0.3
276 0.33
277 0.39
278 0.38
279 0.35
280 0.33
281 0.35
282 0.37
283 0.35
284 0.35
285 0.28
286 0.27
287 0.29
288 0.3
289 0.27
290 0.25
291 0.22
292 0.21
293 0.27
294 0.28
295 0.27
296 0.3
297 0.37
298 0.4
299 0.39
300 0.4
301 0.35
302 0.35
303 0.36
304 0.33
305 0.29
306 0.29
307 0.27
308 0.28
309 0.29
310 0.33
311 0.35
312 0.42
313 0.45
314 0.48
315 0.52
316 0.52
317 0.55
318 0.54
319 0.48
320 0.41
321 0.4
322 0.38
323 0.34
324 0.3
325 0.29
326 0.3
327 0.38
328 0.46
329 0.52
330 0.56
331 0.64
332 0.73
333 0.77
334 0.8
335 0.83
336 0.83
337 0.84
338 0.85
339 0.85
340 0.81
341 0.76
342 0.7
343 0.6
344 0.5
345 0.4
346 0.32
347 0.23
348 0.19
349 0.19
350 0.18
351 0.21
352 0.26
353 0.28
354 0.26
355 0.25