Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KUN8

Protein Details
Accession E3KUN8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-51GVKARSQSRGKRGKKSQKKAEGDGBasic
NLS Segment(s)
PositionSequence
4-46KSGSRRVEARSRSRGKKSESKQEVGVKARSQSRGKRGKKSQKK
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
KEGG pgr:PGTG_13792  -  
Amino Acid Sequences MIRKSGSRRVEARSRSRGKKSESKQEVGVKARSQSRGKRGKKSQKKAEGDGSSVECIWCIHMNQSLCRQAARCVFANGGGAVSSNSSKSGKTTSAVVEKNNPCGPGLAIGTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.79
4 0.78
5 0.77
6 0.78
7 0.76
8 0.77
9 0.74
10 0.69
11 0.67
12 0.67
13 0.65
14 0.6
15 0.56
16 0.47
17 0.45
18 0.47
19 0.46
20 0.45
21 0.46
22 0.51
23 0.58
24 0.62
25 0.67
26 0.73
27 0.78
28 0.82
29 0.85
30 0.86
31 0.86
32 0.84
33 0.78
34 0.76
35 0.67
36 0.57
37 0.48
38 0.39
39 0.29
40 0.24
41 0.19
42 0.11
43 0.09
44 0.09
45 0.07
46 0.06
47 0.07
48 0.11
49 0.12
50 0.14
51 0.19
52 0.22
53 0.22
54 0.22
55 0.22
56 0.23
57 0.26
58 0.28
59 0.24
60 0.22
61 0.21
62 0.21
63 0.22
64 0.17
65 0.13
66 0.09
67 0.08
68 0.06
69 0.08
70 0.08
71 0.07
72 0.09
73 0.1
74 0.1
75 0.12
76 0.15
77 0.16
78 0.17
79 0.19
80 0.22
81 0.3
82 0.32
83 0.33
84 0.39
85 0.4
86 0.46
87 0.45
88 0.41
89 0.33
90 0.32
91 0.3
92 0.25