Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JWV6

Protein Details
Accession E3JWV6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
78-99QLRLAKTKSKSHQRKWPTTLTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR003653  Peptidase_C48_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0016929  F:deSUMOylase activity  
GO:0016926  P:protein desumoylation  
KEGG pgr:PGTG_02972  -  
Pfam View protein in Pfam  
PF02902  Peptidase_C48  
PROSITE View protein in PROSITE  
PS50600  ULP_PROTEASE  
Amino Acid Sequences MAFRKRELRPDEPEDEDEDDPIDMLSSKSRTSSYMKAGPSRDPSQSLLNPITDLPPAEIEPVTPASPDLDLLFSRFGQLRLAKTKSKSHQRKWPTTLTPAQQIVVDEGLRPNNKTVYDLPGASCGIKELQKLSSPPQWLNDEIINFYGSLINLKSHDQISSKALNVHCFSSFFMSQFDLGGHSSVKRWTRKINLFEKDLILFPTNLSNLHWVLGVINNRKKRFEYYDSLAGRNPDVLSKLRRYYQDEWQAKKSEDVDLTEWSDYHPKVPLQSNSSDCGVFVCQFMYSLSQNLINITSQEGRDVSLFDFSAENMPYLRQKMVLEIIRKSFLPDITPESPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.51
3 0.43
4 0.35
5 0.28
6 0.22
7 0.17
8 0.14
9 0.11
10 0.07
11 0.07
12 0.12
13 0.13
14 0.14
15 0.15
16 0.17
17 0.2
18 0.25
19 0.31
20 0.34
21 0.39
22 0.43
23 0.48
24 0.5
25 0.52
26 0.54
27 0.52
28 0.47
29 0.44
30 0.42
31 0.43
32 0.43
33 0.42
34 0.37
35 0.33
36 0.31
37 0.28
38 0.27
39 0.2
40 0.18
41 0.14
42 0.13
43 0.13
44 0.14
45 0.13
46 0.11
47 0.13
48 0.15
49 0.14
50 0.12
51 0.12
52 0.11
53 0.11
54 0.12
55 0.1
56 0.09
57 0.09
58 0.11
59 0.12
60 0.11
61 0.13
62 0.14
63 0.13
64 0.17
65 0.2
66 0.24
67 0.3
68 0.35
69 0.38
70 0.41
71 0.5
72 0.54
73 0.62
74 0.67
75 0.68
76 0.73
77 0.78
78 0.83
79 0.81
80 0.81
81 0.74
82 0.71
83 0.69
84 0.62
85 0.59
86 0.49
87 0.43
88 0.35
89 0.31
90 0.25
91 0.19
92 0.16
93 0.1
94 0.11
95 0.15
96 0.16
97 0.16
98 0.16
99 0.18
100 0.18
101 0.2
102 0.2
103 0.21
104 0.22
105 0.22
106 0.21
107 0.2
108 0.21
109 0.17
110 0.15
111 0.11
112 0.11
113 0.12
114 0.12
115 0.12
116 0.13
117 0.16
118 0.17
119 0.21
120 0.24
121 0.25
122 0.25
123 0.27
124 0.28
125 0.26
126 0.27
127 0.24
128 0.19
129 0.17
130 0.17
131 0.13
132 0.11
133 0.1
134 0.09
135 0.07
136 0.07
137 0.07
138 0.07
139 0.08
140 0.09
141 0.1
142 0.1
143 0.12
144 0.12
145 0.13
146 0.16
147 0.17
148 0.16
149 0.19
150 0.19
151 0.21
152 0.21
153 0.2
154 0.17
155 0.16
156 0.16
157 0.15
158 0.15
159 0.12
160 0.12
161 0.11
162 0.11
163 0.1
164 0.1
165 0.07
166 0.07
167 0.07
168 0.07
169 0.06
170 0.07
171 0.12
172 0.18
173 0.2
174 0.23
175 0.29
176 0.37
177 0.45
178 0.52
179 0.57
180 0.55
181 0.54
182 0.53
183 0.48
184 0.4
185 0.33
186 0.26
187 0.18
188 0.14
189 0.11
190 0.12
191 0.11
192 0.11
193 0.11
194 0.11
195 0.11
196 0.11
197 0.11
198 0.08
199 0.08
200 0.12
201 0.17
202 0.21
203 0.27
204 0.34
205 0.35
206 0.38
207 0.39
208 0.41
209 0.43
210 0.43
211 0.43
212 0.43
213 0.51
214 0.5
215 0.5
216 0.46
217 0.39
218 0.32
219 0.27
220 0.21
221 0.13
222 0.14
223 0.17
224 0.2
225 0.25
226 0.28
227 0.31
228 0.35
229 0.41
230 0.43
231 0.49
232 0.54
233 0.57
234 0.58
235 0.59
236 0.59
237 0.52
238 0.51
239 0.43
240 0.37
241 0.31
242 0.3
243 0.26
244 0.25
245 0.26
246 0.23
247 0.22
248 0.18
249 0.22
250 0.19
251 0.18
252 0.19
253 0.18
254 0.23
255 0.3
256 0.34
257 0.33
258 0.38
259 0.39
260 0.39
261 0.39
262 0.34
263 0.27
264 0.23
265 0.21
266 0.16
267 0.14
268 0.11
269 0.1
270 0.1
271 0.11
272 0.12
273 0.11
274 0.12
275 0.13
276 0.14
277 0.15
278 0.15
279 0.16
280 0.13
281 0.13
282 0.15
283 0.17
284 0.15
285 0.17
286 0.16
287 0.16
288 0.16
289 0.17
290 0.14
291 0.14
292 0.14
293 0.13
294 0.13
295 0.13
296 0.16
297 0.15
298 0.15
299 0.13
300 0.15
301 0.19
302 0.21
303 0.21
304 0.2
305 0.2
306 0.23
307 0.31
308 0.35
309 0.35
310 0.38
311 0.41
312 0.4
313 0.4
314 0.39
315 0.36
316 0.31
317 0.29
318 0.27
319 0.31