Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2H813

Protein Details
Accession Q2H813   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-36QTVNRMWRKNRQTQPGSPCVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000834  Peptidase_M14  
Gene Ontology GO:0005576  C:extracellular region  
GO:0004181  F:metallocarboxypeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00246  Peptidase_M14  
Amino Acid Sequences MTAPHRFPGNECFVHSQTVNRMWRKNRQTQPGSPCVGRDLNRNWDAHWNSTGGAATRPCRSTYRGEKPLDAPETRALAKELEAIQARQGIRLFIDWHAFGQLVMYPYSHTCTTHLPPFSTTRWLGHELAAAMSATHGTRYRAGAACELLAYRASGDSADWALDVLGADHAYTVELRPGLRGRTGAAAAGFRLPEREIRGVGEEAWDGVRRVMGFVLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.35
4 0.34
5 0.4
6 0.45
7 0.44
8 0.51
9 0.54
10 0.64
11 0.69
12 0.73
13 0.73
14 0.76
15 0.77
16 0.78
17 0.8
18 0.78
19 0.73
20 0.63
21 0.55
22 0.49
23 0.47
24 0.39
25 0.38
26 0.36
27 0.41
28 0.44
29 0.44
30 0.4
31 0.45
32 0.46
33 0.42
34 0.37
35 0.29
36 0.25
37 0.25
38 0.25
39 0.16
40 0.16
41 0.15
42 0.17
43 0.2
44 0.21
45 0.22
46 0.24
47 0.27
48 0.33
49 0.41
50 0.48
51 0.52
52 0.53
53 0.54
54 0.54
55 0.58
56 0.53
57 0.43
58 0.36
59 0.3
60 0.3
61 0.28
62 0.25
63 0.19
64 0.15
65 0.15
66 0.15
67 0.13
68 0.14
69 0.15
70 0.14
71 0.14
72 0.18
73 0.18
74 0.16
75 0.16
76 0.12
77 0.12
78 0.13
79 0.13
80 0.1
81 0.12
82 0.1
83 0.1
84 0.1
85 0.1
86 0.08
87 0.07
88 0.08
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.1
95 0.1
96 0.09
97 0.09
98 0.13
99 0.16
100 0.2
101 0.21
102 0.19
103 0.21
104 0.24
105 0.24
106 0.25
107 0.23
108 0.19
109 0.21
110 0.24
111 0.23
112 0.2
113 0.2
114 0.16
115 0.15
116 0.14
117 0.1
118 0.06
119 0.06
120 0.06
121 0.04
122 0.06
123 0.07
124 0.08
125 0.1
126 0.11
127 0.15
128 0.16
129 0.18
130 0.18
131 0.17
132 0.16
133 0.15
134 0.14
135 0.1
136 0.09
137 0.07
138 0.06
139 0.05
140 0.05
141 0.05
142 0.05
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.05
149 0.06
150 0.05
151 0.04
152 0.05
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.05
159 0.05
160 0.07
161 0.08
162 0.09
163 0.12
164 0.15
165 0.17
166 0.18
167 0.18
168 0.18
169 0.21
170 0.21
171 0.19
172 0.17
173 0.16
174 0.15
175 0.17
176 0.15
177 0.12
178 0.13
179 0.13
180 0.16
181 0.2
182 0.23
183 0.22
184 0.24
185 0.27
186 0.26
187 0.26
188 0.24
189 0.18
190 0.16
191 0.17
192 0.17
193 0.13
194 0.13
195 0.15
196 0.13
197 0.14