Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JXU9

Protein Details
Accession E3JXU9    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-25GLFKRLTPWPRVRKSSHQPTLGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, mito_nucl 13.833, cyto_mito 11.333, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002563  Flavin_Rdtase-like_dom  
IPR012349  Split_barrel_FMN-bd  
Gene Ontology GO:0010181  F:FMN binding  
GO:0016491  F:oxidoreductase activity  
KEGG pgr:PGTG_02335  -  
Pfam View protein in Pfam  
PF01613  Flavin_Reduct  
Amino Acid Sequences MQIGLFKRLTPWPRVRKSSHQPTLGILIPGSHLTKHSVVITRMSHHPPFKQVEASRPDFDSGHLSRYTKTPQPDWQVGQGANNAPLPGAKIYQSPAPTKTFVPYESISPSEMYKLMISSVVPRPIGFCSTLSADGNTNLAPFSYFNAAGSDPPCLMMSFTATSVGGDKDTIANIRATKEFVIAIISEPFIEAANYTAIDAPSEVSEWLLSGLTPEPSIKVKPARVQEAAVNMECELEYLHEMFDPSNPKKLTQVIVIGRIKAWHIKKDVLVDDTPLVALEKLMPIGRLGGITYSRTIERFELPRPIWKEEKEKDEVKKVLSQPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.77
4 0.83
5 0.84
6 0.83
7 0.77
8 0.69
9 0.63
10 0.61
11 0.53
12 0.43
13 0.31
14 0.23
15 0.19
16 0.2
17 0.19
18 0.14
19 0.13
20 0.16
21 0.17
22 0.19
23 0.22
24 0.25
25 0.26
26 0.31
27 0.32
28 0.32
29 0.37
30 0.41
31 0.43
32 0.42
33 0.44
34 0.45
35 0.48
36 0.47
37 0.49
38 0.45
39 0.48
40 0.51
41 0.53
42 0.48
43 0.45
44 0.44
45 0.35
46 0.34
47 0.33
48 0.26
49 0.25
50 0.25
51 0.25
52 0.24
53 0.28
54 0.32
55 0.3
56 0.33
57 0.34
58 0.39
59 0.46
60 0.51
61 0.49
62 0.48
63 0.47
64 0.43
65 0.4
66 0.35
67 0.29
68 0.25
69 0.23
70 0.18
71 0.14
72 0.14
73 0.14
74 0.11
75 0.11
76 0.1
77 0.1
78 0.12
79 0.16
80 0.19
81 0.2
82 0.23
83 0.25
84 0.26
85 0.25
86 0.27
87 0.25
88 0.22
89 0.24
90 0.21
91 0.21
92 0.21
93 0.21
94 0.19
95 0.18
96 0.17
97 0.14
98 0.14
99 0.12
100 0.1
101 0.09
102 0.08
103 0.08
104 0.08
105 0.11
106 0.14
107 0.16
108 0.16
109 0.16
110 0.17
111 0.18
112 0.19
113 0.16
114 0.12
115 0.11
116 0.13
117 0.15
118 0.14
119 0.13
120 0.12
121 0.12
122 0.12
123 0.1
124 0.08
125 0.06
126 0.06
127 0.06
128 0.05
129 0.06
130 0.08
131 0.08
132 0.08
133 0.1
134 0.1
135 0.11
136 0.11
137 0.1
138 0.08
139 0.09
140 0.09
141 0.07
142 0.07
143 0.06
144 0.07
145 0.07
146 0.07
147 0.07
148 0.06
149 0.06
150 0.07
151 0.07
152 0.06
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.06
159 0.07
160 0.08
161 0.1
162 0.1
163 0.11
164 0.11
165 0.11
166 0.1
167 0.09
168 0.09
169 0.07
170 0.07
171 0.07
172 0.07
173 0.06
174 0.06
175 0.06
176 0.05
177 0.05
178 0.04
179 0.04
180 0.05
181 0.05
182 0.05
183 0.06
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.04
197 0.05
198 0.06
199 0.06
200 0.07
201 0.07
202 0.08
203 0.1
204 0.11
205 0.15
206 0.19
207 0.23
208 0.28
209 0.34
210 0.38
211 0.37
212 0.38
213 0.36
214 0.36
215 0.35
216 0.29
217 0.24
218 0.18
219 0.17
220 0.15
221 0.13
222 0.08
223 0.06
224 0.07
225 0.07
226 0.07
227 0.07
228 0.08
229 0.08
230 0.11
231 0.18
232 0.19
233 0.27
234 0.27
235 0.27
236 0.3
237 0.34
238 0.33
239 0.28
240 0.34
241 0.29
242 0.38
243 0.38
244 0.36
245 0.32
246 0.31
247 0.29
248 0.29
249 0.31
250 0.28
251 0.31
252 0.34
253 0.36
254 0.42
255 0.44
256 0.4
257 0.36
258 0.32
259 0.29
260 0.25
261 0.22
262 0.16
263 0.13
264 0.09
265 0.09
266 0.08
267 0.08
268 0.09
269 0.1
270 0.1
271 0.09
272 0.11
273 0.11
274 0.1
275 0.1
276 0.11
277 0.12
278 0.13
279 0.15
280 0.16
281 0.17
282 0.18
283 0.2
284 0.2
285 0.25
286 0.27
287 0.3
288 0.37
289 0.37
290 0.46
291 0.48
292 0.52
293 0.52
294 0.54
295 0.6
296 0.58
297 0.64
298 0.62
299 0.65
300 0.66
301 0.68
302 0.66
303 0.6
304 0.61