Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6QPQ5

Protein Details
Accession H6QPQ5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
162-183APLPVSPVKRHPKQPGYTRALVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 8, cyto 3
Family & Domain DBs
KEGG pgr:PGTG_20784  -  
Amino Acid Sequences MSRPQLFQNISLQLGKKPDVTACDIQTVITLAYGESLCFHSSPSSNISVFRTWPNQTHWSTLTQNPICPPRRNPFQQANPGSQPPSSTNNPNCQQNVGRPSHQTIEDIAAAINNIRKGNRGPSDPNIFTGKPCSYCGGLGNWRLSCPRLRRDANLPPPHLVAPLPVSPVKRHPKQPGYTRALVDGMLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.27
4 0.26
5 0.26
6 0.26
7 0.31
8 0.33
9 0.3
10 0.31
11 0.29
12 0.27
13 0.25
14 0.22
15 0.15
16 0.1
17 0.09
18 0.06
19 0.08
20 0.08
21 0.07
22 0.07
23 0.09
24 0.1
25 0.1
26 0.11
27 0.12
28 0.12
29 0.15
30 0.17
31 0.19
32 0.18
33 0.2
34 0.23
35 0.22
36 0.23
37 0.24
38 0.26
39 0.25
40 0.28
41 0.32
42 0.35
43 0.36
44 0.38
45 0.35
46 0.35
47 0.36
48 0.35
49 0.39
50 0.33
51 0.33
52 0.33
53 0.39
54 0.4
55 0.41
56 0.43
57 0.42
58 0.5
59 0.53
60 0.56
61 0.57
62 0.6
63 0.65
64 0.63
65 0.59
66 0.54
67 0.5
68 0.44
69 0.35
70 0.29
71 0.22
72 0.24
73 0.22
74 0.26
75 0.28
76 0.35
77 0.37
78 0.39
79 0.37
80 0.34
81 0.33
82 0.31
83 0.34
84 0.29
85 0.29
86 0.26
87 0.28
88 0.28
89 0.27
90 0.23
91 0.17
92 0.16
93 0.14
94 0.13
95 0.1
96 0.08
97 0.07
98 0.07
99 0.08
100 0.08
101 0.09
102 0.09
103 0.11
104 0.13
105 0.2
106 0.23
107 0.26
108 0.29
109 0.34
110 0.42
111 0.41
112 0.42
113 0.39
114 0.35
115 0.31
116 0.32
117 0.28
118 0.22
119 0.23
120 0.23
121 0.19
122 0.2
123 0.21
124 0.21
125 0.24
126 0.26
127 0.29
128 0.27
129 0.27
130 0.28
131 0.28
132 0.3
133 0.32
134 0.35
135 0.4
136 0.43
137 0.47
138 0.54
139 0.62
140 0.66
141 0.68
142 0.64
143 0.57
144 0.55
145 0.51
146 0.44
147 0.33
148 0.25
149 0.2
150 0.19
151 0.2
152 0.21
153 0.23
154 0.25
155 0.35
156 0.42
157 0.45
158 0.53
159 0.6
160 0.67
161 0.74
162 0.81
163 0.82
164 0.8
165 0.78
166 0.71
167 0.63
168 0.54