Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2GXP7

Protein Details
Accession Q2GXP7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPTRFSKTRKHRGHVSAGKGBasic
NLS Segment(s)
PositionSequence
7-33KTRKHRGHVSAGKGRVGKHRKHPGGRG
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR030878  Ribosomal_L15  
IPR001196  Ribosomal_L15_CS  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00828  Ribosomal_L27A  
PROSITE View protein in PROSITE  
PS00475  RIBOSOMAL_L15  
Amino Acid Sequences MPTRFSKTRKHRGHVSAGKGRVGKHRKHPGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLLRNHDWAPTINIEKLWSLVPVETRDKYVSGAKSDSAPVIDLLSHGYAKLLGKGRLPEIPFVVRARYVSAEAERKVTAAGGVIELVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.77
4 0.7
5 0.68
6 0.6
7 0.55
8 0.55
9 0.55
10 0.52
11 0.54
12 0.63
13 0.67
14 0.72
15 0.76
16 0.75
17 0.75
18 0.7
19 0.62
20 0.52
21 0.46
22 0.4
23 0.37
24 0.32
25 0.29
26 0.28
27 0.27
28 0.27
29 0.28
30 0.32
31 0.36
32 0.37
33 0.37
34 0.38
35 0.41
36 0.42
37 0.38
38 0.34
39 0.27
40 0.26
41 0.24
42 0.25
43 0.22
44 0.23
45 0.25
46 0.26
47 0.26
48 0.27
49 0.28
50 0.28
51 0.29
52 0.32
53 0.3
54 0.27
55 0.27
56 0.22
57 0.2
58 0.19
59 0.19
60 0.13
61 0.12
62 0.12
63 0.12
64 0.12
65 0.1
66 0.08
67 0.06
68 0.07
69 0.08
70 0.11
71 0.14
72 0.14
73 0.16
74 0.16
75 0.16
76 0.17
77 0.21
78 0.19
79 0.18
80 0.19
81 0.18
82 0.18
83 0.19
84 0.17
85 0.13
86 0.11
87 0.09
88 0.08
89 0.08
90 0.06
91 0.07
92 0.08
93 0.07
94 0.07
95 0.07
96 0.08
97 0.08
98 0.14
99 0.17
100 0.17
101 0.2
102 0.23
103 0.25
104 0.28
105 0.29
106 0.26
107 0.25
108 0.26
109 0.26
110 0.25
111 0.25
112 0.22
113 0.21
114 0.22
115 0.2
116 0.2
117 0.2
118 0.25
119 0.29
120 0.29
121 0.31
122 0.28
123 0.26
124 0.25
125 0.22
126 0.16
127 0.12
128 0.11
129 0.09