Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K8R6

Protein Details
Accession E3K8R6   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-65TPTPNARKQKKEFPRKLKVQQRTYNHydrophilic
NLS Segment(s)
PositionSequence
25-57LRPRRAAFRRSHSPAPTPTPNARKQKKEFPRKL
Subcellular Location(s) nucl 19.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
KEGG pgr:PGTG_06489  -  
Amino Acid Sequences MKISRSSAKAPNPMEALSGLRSPELRPRRAAFRRSHSPAPTPTPNARKQKKEFPRKLKVQQRTYNPPPAEIEQTRTIITRKDQSTTVSSYLHRSLPRLSLPEITSPKVFTWIDPHQHTHDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.33
3 0.28
4 0.21
5 0.21
6 0.16
7 0.15
8 0.15
9 0.15
10 0.24
11 0.3
12 0.31
13 0.35
14 0.38
15 0.48
16 0.54
17 0.61
18 0.59
19 0.6
20 0.66
21 0.67
22 0.71
23 0.63
24 0.61
25 0.58
26 0.57
27 0.53
28 0.49
29 0.49
30 0.5
31 0.55
32 0.6
33 0.62
34 0.64
35 0.64
36 0.7
37 0.73
38 0.77
39 0.79
40 0.78
41 0.81
42 0.8
43 0.85
44 0.84
45 0.83
46 0.81
47 0.77
48 0.75
49 0.74
50 0.71
51 0.69
52 0.6
53 0.52
54 0.45
55 0.4
56 0.39
57 0.3
58 0.3
59 0.24
60 0.25
61 0.24
62 0.23
63 0.22
64 0.18
65 0.2
66 0.24
67 0.22
68 0.23
69 0.24
70 0.26
71 0.29
72 0.3
73 0.29
74 0.24
75 0.23
76 0.25
77 0.26
78 0.28
79 0.25
80 0.24
81 0.24
82 0.26
83 0.29
84 0.28
85 0.28
86 0.29
87 0.3
88 0.36
89 0.37
90 0.36
91 0.33
92 0.32
93 0.3
94 0.31
95 0.3
96 0.23
97 0.27
98 0.32
99 0.39
100 0.41
101 0.45