Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KJ65

Protein Details
Accession E3KJ65    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MVKIPKLKTKSKRMIPAGNCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG pgr:PGTG_10060  -  
Amino Acid Sequences MVKIPKLKTKSKRMIPAGNCALELSGLLQCWATTSDVHSMGQCAEAAKSLSTCMKSAKTVNSKKTDSINFHLARLGKNFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.76
3 0.76
4 0.7
5 0.61
6 0.52
7 0.42
8 0.34
9 0.24
10 0.21
11 0.12
12 0.07
13 0.06
14 0.06
15 0.06
16 0.06
17 0.07
18 0.08
19 0.07
20 0.06
21 0.08
22 0.11
23 0.12
24 0.12
25 0.11
26 0.11
27 0.1
28 0.1
29 0.09
30 0.06
31 0.05
32 0.06
33 0.07
34 0.06
35 0.06
36 0.07
37 0.1
38 0.11
39 0.12
40 0.13
41 0.15
42 0.17
43 0.21
44 0.28
45 0.36
46 0.43
47 0.5
48 0.55
49 0.56
50 0.56
51 0.6
52 0.59
53 0.55
54 0.53
55 0.55
56 0.48
57 0.47
58 0.48
59 0.42
60 0.38