Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K1U6

Protein Details
Accession E3K1U6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
87-106FSKFDRQYRQPDPNSKPPHEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, nucl 10.5, cyto_nucl 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031833  DUF4748  
Gene Ontology GO:0016020  C:membrane  
KEGG pgr:PGTG_04227  -  
Pfam View protein in Pfam  
PF15932  DUF4748  
Amino Acid Sequences MNTPGTMALGWGLLLVAGGGGLYFAKKDINERRRDQARRGIRSTDTREWHERVADHQKPQSNQPLDNNATASSGVEPASQPGLASTFSKFDRQYRQPDPNSKPPHET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.03
10 0.03
11 0.04
12 0.05
13 0.06
14 0.15
15 0.25
16 0.34
17 0.42
18 0.46
19 0.55
20 0.63
21 0.67
22 0.65
23 0.64
24 0.65
25 0.64
26 0.63
27 0.58
28 0.52
29 0.55
30 0.57
31 0.54
32 0.48
33 0.46
34 0.47
35 0.45
36 0.42
37 0.37
38 0.29
39 0.27
40 0.33
41 0.32
42 0.3
43 0.32
44 0.35
45 0.35
46 0.39
47 0.42
48 0.35
49 0.34
50 0.34
51 0.38
52 0.36
53 0.36
54 0.32
55 0.23
56 0.22
57 0.19
58 0.16
59 0.1
60 0.08
61 0.08
62 0.08
63 0.07
64 0.08
65 0.09
66 0.09
67 0.08
68 0.07
69 0.08
70 0.09
71 0.1
72 0.1
73 0.13
74 0.14
75 0.2
76 0.21
77 0.26
78 0.35
79 0.41
80 0.49
81 0.54
82 0.63
83 0.67
84 0.75
85 0.77
86 0.78
87 0.8