Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JS88

Protein Details
Accession E3JS88    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-65YERPSPSSGKKSKRPNEKRFPCPDCGHydrophilic
NLS Segment(s)
PositionSequence
48-54GKKSKRP
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
KEGG pgr:PGTG_01602  -  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGSHYSLPLGRDHRFSHSDDSEAVRKGDFSKSTKLRSEVYERPSPSSGKKSKRPNEKRFPCPDCGRMFARAFNMETHRKTHIGYRPHHCPRCQKSFSRRHDLHRHLAAVHDERGKTHQKSISVHPDHPAEEHNSQKMSQFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.42
4 0.38
5 0.37
6 0.34
7 0.36
8 0.34
9 0.33
10 0.3
11 0.22
12 0.21
13 0.22
14 0.26
15 0.26
16 0.26
17 0.33
18 0.39
19 0.44
20 0.48
21 0.48
22 0.45
23 0.45
24 0.48
25 0.46
26 0.46
27 0.48
28 0.44
29 0.45
30 0.45
31 0.42
32 0.39
33 0.42
34 0.44
35 0.45
36 0.52
37 0.59
38 0.65
39 0.75
40 0.81
41 0.82
42 0.85
43 0.86
44 0.87
45 0.85
46 0.82
47 0.77
48 0.71
49 0.66
50 0.57
51 0.52
52 0.44
53 0.39
54 0.36
55 0.3
56 0.27
57 0.23
58 0.22
59 0.2
60 0.23
61 0.22
62 0.23
63 0.24
64 0.24
65 0.24
66 0.23
67 0.29
68 0.3
69 0.33
70 0.38
71 0.41
72 0.49
73 0.58
74 0.62
75 0.59
76 0.63
77 0.63
78 0.68
79 0.67
80 0.66
81 0.67
82 0.72
83 0.76
84 0.76
85 0.73
86 0.72
87 0.77
88 0.74
89 0.72
90 0.66
91 0.6
92 0.5
93 0.48
94 0.44
95 0.37
96 0.35
97 0.31
98 0.26
99 0.26
100 0.31
101 0.36
102 0.33
103 0.37
104 0.37
105 0.38
106 0.42
107 0.49
108 0.55
109 0.52
110 0.51
111 0.49
112 0.48
113 0.43
114 0.41
115 0.36
116 0.31
117 0.32
118 0.36
119 0.36
120 0.35
121 0.34