Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6QVF7

Protein Details
Accession H6QVF7   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
2-22YTANQWPRTNQNKNKMSNNRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 9.666, nucl 8, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013963  DASH_Dad2  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:1990023  C:mitotic spindle midzone  
GO:0044732  C:mitotic spindle pole body  
GO:0008608  P:attachment of spindle microtubules to kinetochore  
GO:0000278  P:mitotic cell cycle  
KEGG pgr:PGTG_22737  -  
Pfam View protein in Pfam  
PF08654  DASH_Dad2  
Amino Acid Sequences MYTANQWPRTNQNKNKMSNNRLSPTALRLIEKQHELEALVQLNQLSHGMSVQLEQLSNQFAQGADGALITESVIQRWQNVFRAAHLAIATRANAINNAAQNPVDMLVRIPVGSAQEDDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.82
3 0.82
4 0.79
5 0.78
6 0.76
7 0.69
8 0.63
9 0.6
10 0.51
11 0.45
12 0.44
13 0.36
14 0.3
15 0.28
16 0.31
17 0.32
18 0.32
19 0.29
20 0.23
21 0.22
22 0.2
23 0.2
24 0.17
25 0.14
26 0.12
27 0.11
28 0.1
29 0.1
30 0.09
31 0.08
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.06
47 0.05
48 0.06
49 0.06
50 0.05
51 0.04
52 0.04
53 0.04
54 0.03
55 0.03
56 0.03
57 0.05
58 0.04
59 0.05
60 0.07
61 0.07
62 0.09
63 0.11
64 0.14
65 0.16
66 0.2
67 0.2
68 0.2
69 0.24
70 0.22
71 0.22
72 0.2
73 0.17
74 0.14
75 0.15
76 0.14
77 0.11
78 0.12
79 0.1
80 0.11
81 0.11
82 0.13
83 0.14
84 0.15
85 0.15
86 0.15
87 0.14
88 0.14
89 0.14
90 0.11
91 0.09
92 0.08
93 0.09
94 0.1
95 0.09
96 0.09
97 0.09
98 0.11
99 0.12
100 0.13