Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3KIV8

Protein Details
Accession E3KIV8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-98YNNNQQQQQHHHHHHRNPQSHQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG pgr:PGTG_10611  -  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MEPEKNYRNNNNNSTQPTTTTATTTTQQQPRSTGGTKRTKQPNTTSSSAKKKRTFDSISNSLPAEESIEAQTIPPNYNNNQQQQQHHHHHHRNPQSHQQQLILNQFNHHHHHVQPQTQPGPNPQFQLSIMPTDEDFPMIRCGWNNCRQGFWILEDLINHLVGENGHVPPDPTAPRGQKCPCEWVGCPKQGKPQGSRMALLVHLRSHTGEKPFSCHKPECDKTFSRTDALAKHVRVSHGEILPTVRSSTTSQLKTSSNSNTNGGKKIKAENESEGEEEGTVVAEELGIQGKSIDCSTGSDLPQLVPPPPGGGSAEKDLLEIINENGKWFNETIDNELRTEEERKSLEELRFKYPSVDFAFLEFVVLKAKIKFALGEREILKSELNLGQLKRNIKNKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.63
3 0.56
4 0.51
5 0.47
6 0.41
7 0.35
8 0.3
9 0.27
10 0.28
11 0.32
12 0.37
13 0.39
14 0.43
15 0.44
16 0.45
17 0.46
18 0.51
19 0.48
20 0.46
21 0.5
22 0.55
23 0.58
24 0.64
25 0.71
26 0.72
27 0.74
28 0.76
29 0.74
30 0.71
31 0.71
32 0.69
33 0.67
34 0.71
35 0.72
36 0.73
37 0.72
38 0.71
39 0.72
40 0.73
41 0.72
42 0.69
43 0.69
44 0.67
45 0.63
46 0.58
47 0.53
48 0.43
49 0.37
50 0.28
51 0.22
52 0.14
53 0.13
54 0.12
55 0.12
56 0.12
57 0.12
58 0.15
59 0.14
60 0.15
61 0.16
62 0.2
63 0.22
64 0.31
65 0.37
66 0.41
67 0.47
68 0.51
69 0.55
70 0.6
71 0.66
72 0.67
73 0.7
74 0.74
75 0.75
76 0.78
77 0.8
78 0.81
79 0.8
80 0.77
81 0.78
82 0.75
83 0.71
84 0.65
85 0.59
86 0.52
87 0.49
88 0.51
89 0.46
90 0.39
91 0.35
92 0.38
93 0.38
94 0.39
95 0.38
96 0.32
97 0.29
98 0.38
99 0.41
100 0.43
101 0.43
102 0.46
103 0.47
104 0.46
105 0.45
106 0.44
107 0.46
108 0.42
109 0.41
110 0.34
111 0.31
112 0.29
113 0.31
114 0.25
115 0.2
116 0.18
117 0.16
118 0.15
119 0.15
120 0.15
121 0.11
122 0.1
123 0.09
124 0.12
125 0.12
126 0.12
127 0.12
128 0.17
129 0.23
130 0.32
131 0.37
132 0.35
133 0.36
134 0.36
135 0.37
136 0.33
137 0.28
138 0.22
139 0.17
140 0.17
141 0.15
142 0.16
143 0.14
144 0.13
145 0.1
146 0.07
147 0.07
148 0.06
149 0.08
150 0.08
151 0.07
152 0.08
153 0.08
154 0.08
155 0.08
156 0.12
157 0.12
158 0.12
159 0.17
160 0.22
161 0.24
162 0.31
163 0.34
164 0.36
165 0.36
166 0.41
167 0.38
168 0.36
169 0.35
170 0.38
171 0.41
172 0.41
173 0.42
174 0.37
175 0.43
176 0.45
177 0.48
178 0.42
179 0.44
180 0.46
181 0.45
182 0.44
183 0.36
184 0.32
185 0.29
186 0.26
187 0.19
188 0.12
189 0.11
190 0.1
191 0.11
192 0.12
193 0.14
194 0.15
195 0.17
196 0.17
197 0.21
198 0.26
199 0.29
200 0.32
201 0.31
202 0.33
203 0.4
204 0.45
205 0.45
206 0.47
207 0.46
208 0.45
209 0.48
210 0.44
211 0.36
212 0.33
213 0.31
214 0.26
215 0.29
216 0.3
217 0.25
218 0.26
219 0.26
220 0.26
221 0.25
222 0.27
223 0.26
224 0.23
225 0.23
226 0.2
227 0.2
228 0.19
229 0.18
230 0.14
231 0.09
232 0.1
233 0.11
234 0.17
235 0.23
236 0.24
237 0.25
238 0.28
239 0.29
240 0.29
241 0.31
242 0.32
243 0.29
244 0.3
245 0.32
246 0.35
247 0.36
248 0.41
249 0.39
250 0.35
251 0.33
252 0.37
253 0.39
254 0.38
255 0.38
256 0.35
257 0.36
258 0.36
259 0.34
260 0.28
261 0.22
262 0.18
263 0.14
264 0.1
265 0.07
266 0.05
267 0.04
268 0.03
269 0.03
270 0.03
271 0.04
272 0.05
273 0.05
274 0.05
275 0.05
276 0.06
277 0.07
278 0.07
279 0.08
280 0.06
281 0.09
282 0.13
283 0.17
284 0.17
285 0.18
286 0.19
287 0.19
288 0.21
289 0.2
290 0.17
291 0.14
292 0.14
293 0.14
294 0.14
295 0.14
296 0.13
297 0.14
298 0.16
299 0.18
300 0.2
301 0.18
302 0.18
303 0.17
304 0.15
305 0.13
306 0.11
307 0.1
308 0.13
309 0.13
310 0.14
311 0.15
312 0.15
313 0.17
314 0.16
315 0.17
316 0.17
317 0.19
318 0.24
319 0.3
320 0.31
321 0.29
322 0.29
323 0.29
324 0.26
325 0.28
326 0.23
327 0.22
328 0.22
329 0.24
330 0.29
331 0.34
332 0.37
333 0.42
334 0.44
335 0.45
336 0.46
337 0.45
338 0.44
339 0.39
340 0.4
341 0.37
342 0.36
343 0.29
344 0.29
345 0.31
346 0.26
347 0.26
348 0.19
349 0.14
350 0.14
351 0.14
352 0.15
353 0.14
354 0.16
355 0.16
356 0.17
357 0.2
358 0.21
359 0.31
360 0.3
361 0.35
362 0.35
363 0.37
364 0.38
365 0.35
366 0.31
367 0.21
368 0.25
369 0.21
370 0.24
371 0.26
372 0.26
373 0.33
374 0.38
375 0.45
376 0.49