Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JQT5

Protein Details
Accession E3JQT5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
163-186TKNAATSKAVKKPKPKPTRIGGLAHydrophilic
NLS Segment(s)
PositionSequence
170-181KAVKKPKPKPTR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029003  CENP-S/Mhf1  
IPR009072  Histone-fold  
Gene Ontology GO:0071821  C:FANCM-MHF complex  
GO:0003682  F:chromatin binding  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
GO:0031297  P:replication fork processing  
GO:0000712  P:resolution of meiotic recombination intermediates  
KEGG pgr:PGTG_00113  -  
Pfam View protein in Pfam  
PF15630  CENP-S  
Amino Acid Sequences MVRARTTTGGDFKDSSRKRKPTDGEDSIEDLDVDPQEEQRDIKDDGDEQTLTTGIDETSLKAAVWYTVAQIAQEEEIELGRSMSEPFVASLTELVYAQAENLALELKAFAAHAGRSTIREEDVKLVCRKSSVLKEMLEEEARRFMTAAGSGSTGKTMASGATTKNAATSKAVKKPKPKPTRIGGLAGPSSSRNPIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.51
4 0.57
5 0.59
6 0.67
7 0.72
8 0.71
9 0.75
10 0.73
11 0.67
12 0.61
13 0.59
14 0.5
15 0.43
16 0.33
17 0.23
18 0.19
19 0.14
20 0.12
21 0.09
22 0.09
23 0.11
24 0.12
25 0.12
26 0.11
27 0.15
28 0.16
29 0.16
30 0.17
31 0.17
32 0.18
33 0.21
34 0.2
35 0.15
36 0.14
37 0.14
38 0.12
39 0.1
40 0.09
41 0.05
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.08
52 0.07
53 0.06
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.06
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.04
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.04
98 0.04
99 0.05
100 0.07
101 0.07
102 0.09
103 0.1
104 0.11
105 0.12
106 0.13
107 0.13
108 0.17
109 0.19
110 0.23
111 0.24
112 0.24
113 0.23
114 0.23
115 0.23
116 0.24
117 0.27
118 0.27
119 0.28
120 0.28
121 0.29
122 0.31
123 0.32
124 0.29
125 0.23
126 0.2
127 0.2
128 0.2
129 0.18
130 0.17
131 0.14
132 0.13
133 0.14
134 0.13
135 0.1
136 0.11
137 0.11
138 0.11
139 0.11
140 0.1
141 0.08
142 0.07
143 0.07
144 0.06
145 0.07
146 0.09
147 0.1
148 0.13
149 0.14
150 0.13
151 0.17
152 0.18
153 0.17
154 0.19
155 0.27
156 0.32
157 0.41
158 0.5
159 0.53
160 0.63
161 0.71
162 0.78
163 0.81
164 0.81
165 0.81
166 0.81
167 0.85
168 0.78
169 0.73
170 0.65
171 0.61
172 0.54
173 0.46
174 0.38
175 0.3
176 0.28