Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K3Q1

Protein Details
Accession E3K3Q1    Localization Confidence High Confidence Score 19.6
NoLS Segment(s)
PositionSequenceProtein Nature
117-143AATQQPVTKRPPKSKNPPPSNNPQPVAHydrophilic
389-409VLEKRTPRVRSWKKIRREVVGHydrophilic
NLS Segment(s)
PositionSequence
127-131PPKSK
148-152PAKKR
311-318TKSKAKKG
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
KEGG pgr:PGTG_04659  -  
Amino Acid Sequences MSQQPTNNGTTTGGFKLKLKLNGPPPPPQQQQQQQQQQYHHHQTNRYPEEDEQEDQLASSEVDDDEEEDEQEDGEEEDGLEGEEHEGFEEDLSRNHQAEQQENSFATLPPHHHHQPAATQQPVTKRPPKSKNPPPSNNPQPVAPANPPAKKRKTNSQPIAIHPQRGHHLTTDQDGPDSEMSSYTSDQPHQAAPRSRTIKITHPSINPKSKSKTNLVPLSDAELLSAAAGPQYPPQDSSAGVVSGKSKAASSAVTGLKTNPPKKKQANSEGSKKRAISNNPSATTAPHSNPPAVPNQPATGAAAKAPAGSGTKSKAKKGSKLSQAKTQDPFQPTPVPSGVTTPILRPPPGPRPQHDYSLGPPPPPPVPALKPFPVGPPPRAQGQFLPAQVLEKRTPRVRSWKKIRREVVGISGIPFWIWTYAGDEHSDYAIAKQHQLSQAVGTPSLHLSNQETTQYFPSGQPSRPASVASSHAKPSPMRNPSGASRAKYVPAEPSSGNLGGPILPASFRRPPMSIGSPLNGKPAEALGSKKPASSQLDPVSRAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.33
4 0.38
5 0.43
6 0.42
7 0.46
8 0.52
9 0.6
10 0.61
11 0.63
12 0.63
13 0.65
14 0.68
15 0.66
16 0.67
17 0.67
18 0.73
19 0.74
20 0.78
21 0.77
22 0.77
23 0.78
24 0.77
25 0.78
26 0.77
27 0.74
28 0.69
29 0.67
30 0.69
31 0.73
32 0.69
33 0.62
34 0.55
35 0.5
36 0.51
37 0.49
38 0.43
39 0.34
40 0.3
41 0.27
42 0.24
43 0.23
44 0.16
45 0.12
46 0.1
47 0.09
48 0.07
49 0.08
50 0.08
51 0.09
52 0.09
53 0.1
54 0.1
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.07
73 0.07
74 0.07
75 0.07
76 0.1
77 0.1
78 0.11
79 0.15
80 0.18
81 0.18
82 0.19
83 0.23
84 0.23
85 0.27
86 0.32
87 0.31
88 0.31
89 0.31
90 0.31
91 0.29
92 0.26
93 0.23
94 0.21
95 0.22
96 0.22
97 0.29
98 0.31
99 0.32
100 0.32
101 0.33
102 0.36
103 0.41
104 0.44
105 0.39
106 0.37
107 0.38
108 0.44
109 0.48
110 0.48
111 0.48
112 0.49
113 0.58
114 0.66
115 0.74
116 0.77
117 0.81
118 0.85
119 0.87
120 0.88
121 0.85
122 0.85
123 0.85
124 0.82
125 0.73
126 0.63
127 0.57
128 0.5
129 0.48
130 0.39
131 0.37
132 0.36
133 0.4
134 0.45
135 0.49
136 0.55
137 0.59
138 0.62
139 0.65
140 0.69
141 0.74
142 0.76
143 0.77
144 0.73
145 0.7
146 0.76
147 0.67
148 0.61
149 0.51
150 0.47
151 0.41
152 0.39
153 0.35
154 0.25
155 0.26
156 0.22
157 0.24
158 0.25
159 0.21
160 0.19
161 0.18
162 0.18
163 0.16
164 0.15
165 0.12
166 0.09
167 0.1
168 0.11
169 0.12
170 0.12
171 0.14
172 0.14
173 0.15
174 0.16
175 0.18
176 0.2
177 0.25
178 0.29
179 0.3
180 0.38
181 0.41
182 0.41
183 0.42
184 0.42
185 0.45
186 0.42
187 0.46
188 0.42
189 0.44
190 0.51
191 0.54
192 0.6
193 0.55
194 0.57
195 0.56
196 0.55
197 0.55
198 0.52
199 0.51
200 0.51
201 0.54
202 0.49
203 0.46
204 0.41
205 0.39
206 0.35
207 0.27
208 0.19
209 0.12
210 0.11
211 0.09
212 0.08
213 0.04
214 0.03
215 0.03
216 0.04
217 0.06
218 0.08
219 0.08
220 0.09
221 0.11
222 0.11
223 0.11
224 0.12
225 0.11
226 0.1
227 0.1
228 0.09
229 0.09
230 0.09
231 0.09
232 0.08
233 0.07
234 0.07
235 0.08
236 0.08
237 0.07
238 0.13
239 0.13
240 0.14
241 0.14
242 0.15
243 0.2
244 0.27
245 0.33
246 0.35
247 0.38
248 0.46
249 0.53
250 0.59
251 0.62
252 0.65
253 0.68
254 0.66
255 0.73
256 0.71
257 0.67
258 0.63
259 0.55
260 0.49
261 0.45
262 0.44
263 0.42
264 0.45
265 0.47
266 0.45
267 0.46
268 0.42
269 0.36
270 0.36
271 0.31
272 0.22
273 0.2
274 0.2
275 0.19
276 0.2
277 0.21
278 0.21
279 0.2
280 0.2
281 0.17
282 0.17
283 0.16
284 0.16
285 0.16
286 0.12
287 0.11
288 0.09
289 0.09
290 0.08
291 0.08
292 0.07
293 0.07
294 0.07
295 0.07
296 0.09
297 0.12
298 0.19
299 0.21
300 0.24
301 0.32
302 0.35
303 0.42
304 0.49
305 0.54
306 0.57
307 0.65
308 0.65
309 0.65
310 0.66
311 0.64
312 0.58
313 0.53
314 0.49
315 0.45
316 0.43
317 0.38
318 0.38
319 0.34
320 0.34
321 0.3
322 0.26
323 0.21
324 0.22
325 0.2
326 0.17
327 0.17
328 0.15
329 0.19
330 0.2
331 0.2
332 0.2
333 0.24
334 0.3
335 0.38
336 0.42
337 0.4
338 0.47
339 0.49
340 0.52
341 0.5
342 0.43
343 0.37
344 0.42
345 0.4
346 0.32
347 0.3
348 0.27
349 0.26
350 0.24
351 0.23
352 0.19
353 0.22
354 0.27
355 0.32
356 0.31
357 0.32
358 0.32
359 0.34
360 0.37
361 0.36
362 0.33
363 0.34
364 0.34
365 0.38
366 0.38
367 0.36
368 0.3
369 0.31
370 0.32
371 0.27
372 0.27
373 0.2
374 0.22
375 0.21
376 0.24
377 0.23
378 0.23
379 0.28
380 0.32
381 0.37
382 0.4
383 0.5
384 0.56
385 0.63
386 0.7
387 0.74
388 0.78
389 0.84
390 0.83
391 0.78
392 0.73
393 0.65
394 0.6
395 0.56
396 0.46
397 0.38
398 0.32
399 0.26
400 0.2
401 0.18
402 0.11
403 0.07
404 0.07
405 0.06
406 0.1
407 0.12
408 0.13
409 0.15
410 0.15
411 0.15
412 0.15
413 0.15
414 0.11
415 0.1
416 0.15
417 0.15
418 0.17
419 0.18
420 0.23
421 0.26
422 0.28
423 0.27
424 0.23
425 0.27
426 0.26
427 0.25
428 0.2
429 0.18
430 0.17
431 0.18
432 0.16
433 0.13
434 0.15
435 0.17
436 0.19
437 0.22
438 0.21
439 0.22
440 0.24
441 0.25
442 0.23
443 0.21
444 0.27
445 0.28
446 0.29
447 0.34
448 0.35
449 0.37
450 0.36
451 0.36
452 0.29
453 0.28
454 0.32
455 0.31
456 0.3
457 0.3
458 0.32
459 0.34
460 0.35
461 0.39
462 0.43
463 0.44
464 0.44
465 0.44
466 0.46
467 0.48
468 0.55
469 0.53
470 0.46
471 0.44
472 0.43
473 0.45
474 0.42
475 0.39
476 0.38
477 0.34
478 0.35
479 0.3
480 0.3
481 0.3
482 0.29
483 0.27
484 0.19
485 0.17
486 0.14
487 0.14
488 0.12
489 0.08
490 0.09
491 0.11
492 0.17
493 0.23
494 0.26
495 0.29
496 0.3
497 0.33
498 0.39
499 0.43
500 0.44
501 0.41
502 0.41
503 0.43
504 0.42
505 0.46
506 0.38
507 0.32
508 0.27
509 0.24
510 0.25
511 0.22
512 0.25
513 0.25
514 0.33
515 0.33
516 0.33
517 0.34
518 0.37
519 0.42
520 0.43
521 0.46
522 0.47
523 0.53