Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KPN9

Protein Details
Accession E3KPN9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-64HTHTPHQETNQRNRRRKRKGKNALFAQVKHydrophilic
NLS Segment(s)
PositionSequence
47-56RNRRRKRKGK
Subcellular Location(s) mito 10, nucl 6, cyto_mito 6, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043141  Ribosomal_L10-like_sf  
IPR001790  Ribosomal_L10P  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
GO:0042273  P:ribosomal large subunit biogenesis  
GO:0006364  P:rRNA processing  
KEGG pgr:PGTG_12230  -  
Pfam View protein in Pfam  
PF00466  Ribosomal_L10  
Amino Acid Sequences MEIFMCQVSLAVFFNFTTHTLARGTCTHQLDLQGQHTHTPHQETNQRNRRRKRKGKNALFAQVKQASEKFQSVWLFTVDHVWTPYLQDIRSSWKPSQIYMGRNAVMRLGLRSKEEDERKPGLGTTGKLLEGDTGLLLMNIPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.11
4 0.14
5 0.13
6 0.14
7 0.15
8 0.15
9 0.18
10 0.19
11 0.22
12 0.25
13 0.28
14 0.27
15 0.28
16 0.3
17 0.31
18 0.32
19 0.32
20 0.29
21 0.26
22 0.29
23 0.28
24 0.28
25 0.26
26 0.28
27 0.25
28 0.27
29 0.34
30 0.38
31 0.48
32 0.56
33 0.64
34 0.67
35 0.76
36 0.81
37 0.85
38 0.89
39 0.89
40 0.91
41 0.92
42 0.92
43 0.92
44 0.87
45 0.85
46 0.79
47 0.68
48 0.63
49 0.54
50 0.44
51 0.36
52 0.3
53 0.23
54 0.2
55 0.2
56 0.15
57 0.15
58 0.16
59 0.15
60 0.15
61 0.14
62 0.13
63 0.12
64 0.14
65 0.1
66 0.1
67 0.1
68 0.1
69 0.09
70 0.09
71 0.12
72 0.1
73 0.1
74 0.11
75 0.11
76 0.19
77 0.24
78 0.27
79 0.26
80 0.31
81 0.31
82 0.31
83 0.39
84 0.36
85 0.35
86 0.35
87 0.38
88 0.33
89 0.33
90 0.33
91 0.24
92 0.21
93 0.18
94 0.16
95 0.17
96 0.17
97 0.18
98 0.21
99 0.24
100 0.31
101 0.37
102 0.39
103 0.42
104 0.44
105 0.44
106 0.42
107 0.39
108 0.35
109 0.33
110 0.28
111 0.27
112 0.25
113 0.24
114 0.23
115 0.23
116 0.18
117 0.15
118 0.14
119 0.09
120 0.07
121 0.07
122 0.06