Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6QUM0

Protein Details
Accession H6QUM0    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-44ASRLSPKTPPTLRRKPRGSQTIRSPPSHydrophilic
94-131FPSRRPRRSLSRSRSPRRMRRSKSRSRSPRPDRRSSPGBasic
NLS Segment(s)
PositionSequence
95-134PSRRPRRSLSRSRSPRRMRRSKSRSRSPRPDRRSSPGRYR
Subcellular Location(s) nucl 12, mito 9, cyto_mito 7.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003729  F:mRNA binding  
KEGG pgr:PGTG_22455  -  
Amino Acid Sequences MPERAEKVLIILAGIRGASRLSPKTPPTLRRKPRGSQTIRSPPSTSPPNPQYLIRMFPERNFAGHSNGFGMAHKDSERWGNDVRRREDENFRNFPSRRPRRSLSRSRSPRRMRRSKSRSRSPRPDRRSSPGRYRHDRDRDDVSPKYAYSNGRPGGFSSRGRGHFEDSGRRATGREMAALEASKRSVKENRVYVGNLAFSVKWSDLKDFMREGGVVKMVVAKGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.07
4 0.07
5 0.09
6 0.14
7 0.17
8 0.2
9 0.27
10 0.3
11 0.39
12 0.47
13 0.54
14 0.59
15 0.66
16 0.73
17 0.76
18 0.81
19 0.8
20 0.83
21 0.84
22 0.81
23 0.79
24 0.8
25 0.81
26 0.77
27 0.72
28 0.64
29 0.55
30 0.55
31 0.54
32 0.46
33 0.44
34 0.45
35 0.47
36 0.46
37 0.45
38 0.43
39 0.38
40 0.39
41 0.33
42 0.35
43 0.31
44 0.31
45 0.36
46 0.31
47 0.29
48 0.29
49 0.27
50 0.26
51 0.25
52 0.24
53 0.19
54 0.19
55 0.18
56 0.15
57 0.16
58 0.11
59 0.12
60 0.12
61 0.11
62 0.11
63 0.17
64 0.17
65 0.18
66 0.23
67 0.3
68 0.35
69 0.43
70 0.46
71 0.45
72 0.48
73 0.49
74 0.54
75 0.54
76 0.56
77 0.53
78 0.51
79 0.54
80 0.5
81 0.53
82 0.55
83 0.57
84 0.55
85 0.57
86 0.59
87 0.61
88 0.7
89 0.74
90 0.71
91 0.72
92 0.77
93 0.78
94 0.83
95 0.82
96 0.82
97 0.82
98 0.84
99 0.81
100 0.81
101 0.84
102 0.84
103 0.84
104 0.86
105 0.86
106 0.85
107 0.89
108 0.88
109 0.89
110 0.86
111 0.86
112 0.8
113 0.77
114 0.76
115 0.71
116 0.71
117 0.7
118 0.71
119 0.7
120 0.7
121 0.72
122 0.73
123 0.7
124 0.63
125 0.6
126 0.56
127 0.54
128 0.5
129 0.43
130 0.34
131 0.32
132 0.3
133 0.26
134 0.25
135 0.23
136 0.29
137 0.29
138 0.28
139 0.29
140 0.28
141 0.31
142 0.33
143 0.3
144 0.28
145 0.32
146 0.34
147 0.38
148 0.38
149 0.36
150 0.37
151 0.39
152 0.42
153 0.38
154 0.4
155 0.36
156 0.35
157 0.31
158 0.27
159 0.3
160 0.22
161 0.21
162 0.18
163 0.18
164 0.19
165 0.19
166 0.19
167 0.14
168 0.15
169 0.15
170 0.15
171 0.19
172 0.24
173 0.3
174 0.37
175 0.42
176 0.44
177 0.46
178 0.47
179 0.44
180 0.4
181 0.34
182 0.26
183 0.22
184 0.18
185 0.15
186 0.17
187 0.16
188 0.17
189 0.18
190 0.21
191 0.25
192 0.28
193 0.31
194 0.29
195 0.29
196 0.27
197 0.26
198 0.24
199 0.21
200 0.21
201 0.16
202 0.15
203 0.18
204 0.16