Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JQ97

Protein Details
Accession E3JQ97    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-76SAHWKSIGTPKKNRKTRCKLKTHQGASKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021137  Ribosomal_L35  
IPR018265  Ribosomal_L35_CS  
IPR001706  Ribosomal_L35_non-mt  
IPR037229  Ribosomal_L35_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pgr:PGTG_00231  -  
Pfam View protein in Pfam  
PF01632  Ribosomal_L35p  
PROSITE View protein in PROSITE  
PS00936  RIBOSOMAL_L35  
Amino Acid Sequences MNILRQLILRTIKPSLSSYQSVPLKPIHPFRIQQQQQQHQQRAFSISPSAHWKSIGTPKKNRKTRCKLKTHQGASKRFFVTGRGQFKRVQAGTQHLMTGLSQTRKRKLKPMVIVKRSQTSLLRKLLPYAGKRAGFRKLDQSETVWWRSGKLQKSGVALKQAIQRSHALKRSQLLSTPSSSPATTTISE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.32
4 0.32
5 0.3
6 0.36
7 0.4
8 0.38
9 0.37
10 0.36
11 0.34
12 0.37
13 0.43
14 0.39
15 0.4
16 0.42
17 0.45
18 0.53
19 0.54
20 0.56
21 0.58
22 0.61
23 0.66
24 0.73
25 0.74
26 0.65
27 0.63
28 0.57
29 0.53
30 0.44
31 0.35
32 0.3
33 0.23
34 0.23
35 0.29
36 0.3
37 0.24
38 0.24
39 0.23
40 0.25
41 0.34
42 0.41
43 0.41
44 0.48
45 0.58
46 0.68
47 0.76
48 0.79
49 0.81
50 0.83
51 0.86
52 0.87
53 0.87
54 0.84
55 0.86
56 0.88
57 0.83
58 0.8
59 0.78
60 0.76
61 0.69
62 0.68
63 0.58
64 0.48
65 0.41
66 0.37
67 0.36
68 0.36
69 0.42
70 0.37
71 0.38
72 0.4
73 0.41
74 0.45
75 0.37
76 0.31
77 0.23
78 0.26
79 0.26
80 0.24
81 0.22
82 0.15
83 0.15
84 0.13
85 0.13
86 0.12
87 0.14
88 0.18
89 0.21
90 0.29
91 0.35
92 0.37
93 0.44
94 0.49
95 0.53
96 0.58
97 0.66
98 0.68
99 0.67
100 0.7
101 0.64
102 0.6
103 0.52
104 0.46
105 0.4
106 0.37
107 0.38
108 0.38
109 0.39
110 0.35
111 0.36
112 0.38
113 0.38
114 0.34
115 0.33
116 0.34
117 0.35
118 0.37
119 0.38
120 0.41
121 0.39
122 0.38
123 0.42
124 0.39
125 0.4
126 0.4
127 0.39
128 0.38
129 0.4
130 0.41
131 0.34
132 0.31
133 0.28
134 0.34
135 0.38
136 0.37
137 0.38
138 0.4
139 0.4
140 0.46
141 0.5
142 0.46
143 0.46
144 0.41
145 0.38
146 0.41
147 0.42
148 0.38
149 0.35
150 0.37
151 0.36
152 0.44
153 0.47
154 0.43
155 0.41
156 0.46
157 0.47
158 0.44
159 0.44
160 0.4
161 0.37
162 0.38
163 0.36
164 0.34
165 0.33
166 0.3
167 0.26
168 0.24