Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6QTN0

Protein Details
Accession H6QTN0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-30AGQARPRKRERARSEDPLKPBasic
NLS Segment(s)
PositionSequence
16-21PRKRER
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
KEGG pgr:PGTG_22162  -  
Amino Acid Sequences MPAPIECEISAGQARPRKRERARSEDPLKPGLCRTFFLFHPSQLLSPASPAHHGTMGSQKIRMGHSNRFWYKAGPLLAVSVSTIFPPAPPHRKLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.36
3 0.43
4 0.5
5 0.57
6 0.66
7 0.7
8 0.74
9 0.78
10 0.79
11 0.8
12 0.76
13 0.7
14 0.66
15 0.57
16 0.48
17 0.44
18 0.39
19 0.33
20 0.28
21 0.28
22 0.25
23 0.24
24 0.29
25 0.27
26 0.22
27 0.23
28 0.23
29 0.19
30 0.17
31 0.18
32 0.11
33 0.11
34 0.11
35 0.09
36 0.1
37 0.11
38 0.1
39 0.1
40 0.1
41 0.11
42 0.17
43 0.2
44 0.19
45 0.19
46 0.19
47 0.2
48 0.23
49 0.28
50 0.26
51 0.29
52 0.35
53 0.45
54 0.46
55 0.47
56 0.46
57 0.41
58 0.39
59 0.37
60 0.32
61 0.23
62 0.21
63 0.18
64 0.18
65 0.16
66 0.14
67 0.1
68 0.09
69 0.08
70 0.08
71 0.07
72 0.08
73 0.15
74 0.24
75 0.31