Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KK72

Protein Details
Accession E3KK72    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-59KSKTNKVTVKTVKRTKRKRITTIHGLDHydrophilic
NLS Segment(s)
PositionSequence
8-51KKKKAETEALKKEAKEDAKASRIKEKSKTNKVTVKTVKRTKRKR
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046447  DENR_C  
IPR001950  SUI1  
IPR036877  SUI1_dom_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003729  F:mRNA binding  
GO:0003743  F:translation initiation factor activity  
GO:0001731  P:formation of translation preinitiation complex  
GO:0002188  P:translation reinitiation  
KEGG pgr:PGTG_10856  -  
Pfam View protein in Pfam  
PF01253  SUI1  
PROSITE View protein in PROSITE  
PS50296  SUI1  
CDD cd11607  DENR_C  
Amino Acid Sequences MSVEEVEKKKKAETEALKKEAKEDAKASRIKEKSKTNKVTVKTVKRTKRKRITTIHGLDLFGVDLKKLAKLFASKFATGSSVTKNNQGEDEIVIQGDVSDEVLDLFDSTTGKFAEIIGNGIIPDDDIVFVDDTKKKKPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.66
4 0.66
5 0.61
6 0.59
7 0.56
8 0.49
9 0.43
10 0.37
11 0.37
12 0.41
13 0.45
14 0.45
15 0.47
16 0.49
17 0.5
18 0.54
19 0.58
20 0.61
21 0.68
22 0.73
23 0.71
24 0.73
25 0.71
26 0.73
27 0.72
28 0.71
29 0.7
30 0.72
31 0.74
32 0.77
33 0.84
34 0.85
35 0.86
36 0.85
37 0.84
38 0.84
39 0.83
40 0.82
41 0.76
42 0.71
43 0.62
44 0.52
45 0.43
46 0.34
47 0.25
48 0.16
49 0.12
50 0.06
51 0.05
52 0.05
53 0.07
54 0.07
55 0.07
56 0.07
57 0.11
58 0.12
59 0.2
60 0.23
61 0.22
62 0.22
63 0.22
64 0.22
65 0.2
66 0.2
67 0.15
68 0.17
69 0.17
70 0.23
71 0.23
72 0.23
73 0.22
74 0.22
75 0.19
76 0.15
77 0.16
78 0.11
79 0.1
80 0.09
81 0.08
82 0.07
83 0.06
84 0.05
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.05
95 0.05
96 0.07
97 0.08
98 0.08
99 0.08
100 0.08
101 0.11
102 0.11
103 0.13
104 0.11
105 0.11
106 0.11
107 0.11
108 0.1
109 0.06
110 0.06
111 0.05
112 0.05
113 0.05
114 0.07
115 0.08
116 0.08
117 0.14
118 0.18
119 0.21