Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6QUY7

Protein Details
Accession H6QUY7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
21-47AAAARLAPRRKRVWKANKIFRNQLKFIHydrophilic
NLS Segment(s)
PositionSequence
28-35PRRKRVWK
Subcellular Location(s) plas 24, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001046  NRAMP_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0015086  F:cadmium ion transmembrane transporter activity  
GO:0005384  F:manganese ion transmembrane transporter activity  
GO:0030026  P:intracellular manganese ion homeostasis  
GO:0006826  P:iron ion transport  
KEGG pgr:PGTG_22574  -  
Pfam View protein in Pfam  
PF01566  Nramp  
Amino Acid Sequences MAIADSSDPTEHDHPSSSSAAAAARLAPRRKRVWKANKIFRNQLKFIGPGIVAAVAYCDPGNWATDLEAGSTFGYAHLFVILSASMMAIVLQVLATRLGYVTGKDLAQHCRARFYDRPTHTKLWRWACLYPLYAVCEAGIIFTDLAELLGSAIALKMLIPRLPLWVGVLLTSTDVFIVLAFFNSYPEISSRSRRSMHIFEFSVSILVLIVLVSFIVLIVNVQPDWGDTFRGYLPSRTMIVNGGLYLAVSIVGATVMPHSIFLGSKVAISDRLKPSPMEDKETQLGRSPDPSTSPNLSPIQQSGDLPSLQIARAAGLRLHQTSPVNDYVSSVEHCKAHLAHASFDVAISLFTLALPINSAILIVAAAAFYYSGSDGPSQVADLASAHQLLTSRVGVGSGYIFAIALLVAGQAASITVTLAGQIVSEGFIEWRTRPFVRRLVTRLIGIVPSAIVAASVGPQGVDDLLIGSQVALSMVLPFVVLPLIIFTSDPQTMTMPNYHSLPSGSPIGSPTTTHPTKPPGENENEGSLALMSSNESTFENNLATKIIVGLIFCICCVANVYAIVQLAQGRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.28
4 0.23
5 0.2
6 0.19
7 0.18
8 0.16
9 0.15
10 0.15
11 0.19
12 0.27
13 0.35
14 0.4
15 0.47
16 0.56
17 0.65
18 0.71
19 0.76
20 0.8
21 0.83
22 0.87
23 0.9
24 0.9
25 0.89
26 0.89
27 0.87
28 0.85
29 0.76
30 0.71
31 0.64
32 0.56
33 0.5
34 0.44
35 0.34
36 0.26
37 0.24
38 0.18
39 0.14
40 0.12
41 0.12
42 0.07
43 0.08
44 0.08
45 0.07
46 0.08
47 0.09
48 0.1
49 0.09
50 0.1
51 0.1
52 0.12
53 0.13
54 0.12
55 0.12
56 0.11
57 0.11
58 0.1
59 0.1
60 0.08
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.07
68 0.07
69 0.06
70 0.06
71 0.05
72 0.04
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.07
87 0.08
88 0.1
89 0.11
90 0.12
91 0.15
92 0.18
93 0.22
94 0.3
95 0.35
96 0.33
97 0.39
98 0.4
99 0.44
100 0.47
101 0.49
102 0.51
103 0.52
104 0.59
105 0.59
106 0.65
107 0.63
108 0.65
109 0.66
110 0.64
111 0.64
112 0.6
113 0.54
114 0.5
115 0.49
116 0.42
117 0.36
118 0.3
119 0.27
120 0.23
121 0.22
122 0.18
123 0.15
124 0.13
125 0.1
126 0.09
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.04
134 0.04
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.05
144 0.06
145 0.07
146 0.09
147 0.09
148 0.12
149 0.13
150 0.13
151 0.12
152 0.12
153 0.11
154 0.1
155 0.1
156 0.08
157 0.08
158 0.08
159 0.07
160 0.05
161 0.05
162 0.05
163 0.04
164 0.05
165 0.04
166 0.04
167 0.05
168 0.05
169 0.06
170 0.06
171 0.06
172 0.06
173 0.07
174 0.12
175 0.14
176 0.21
177 0.25
178 0.3
179 0.33
180 0.35
181 0.4
182 0.42
183 0.43
184 0.42
185 0.39
186 0.34
187 0.32
188 0.3
189 0.23
190 0.16
191 0.13
192 0.06
193 0.05
194 0.04
195 0.03
196 0.03
197 0.02
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.03
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.06
212 0.07
213 0.08
214 0.07
215 0.09
216 0.09
217 0.14
218 0.14
219 0.14
220 0.15
221 0.16
222 0.17
223 0.15
224 0.15
225 0.12
226 0.13
227 0.11
228 0.1
229 0.08
230 0.06
231 0.06
232 0.05
233 0.04
234 0.03
235 0.03
236 0.03
237 0.02
238 0.02
239 0.02
240 0.02
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.04
247 0.04
248 0.05
249 0.06
250 0.06
251 0.07
252 0.07
253 0.07
254 0.11
255 0.13
256 0.19
257 0.21
258 0.22
259 0.23
260 0.23
261 0.25
262 0.3
263 0.3
264 0.3
265 0.27
266 0.29
267 0.31
268 0.32
269 0.3
270 0.25
271 0.25
272 0.19
273 0.21
274 0.19
275 0.16
276 0.18
277 0.18
278 0.18
279 0.2
280 0.2
281 0.21
282 0.22
283 0.22
284 0.2
285 0.2
286 0.18
287 0.16
288 0.16
289 0.13
290 0.14
291 0.13
292 0.12
293 0.12
294 0.1
295 0.09
296 0.09
297 0.07
298 0.06
299 0.07
300 0.07
301 0.07
302 0.07
303 0.1
304 0.11
305 0.11
306 0.13
307 0.14
308 0.14
309 0.18
310 0.18
311 0.17
312 0.15
313 0.16
314 0.14
315 0.14
316 0.15
317 0.13
318 0.13
319 0.12
320 0.12
321 0.13
322 0.12
323 0.13
324 0.17
325 0.16
326 0.15
327 0.16
328 0.16
329 0.14
330 0.14
331 0.12
332 0.07
333 0.06
334 0.05
335 0.04
336 0.03
337 0.03
338 0.04
339 0.04
340 0.04
341 0.04
342 0.04
343 0.04
344 0.04
345 0.04
346 0.03
347 0.03
348 0.03
349 0.03
350 0.03
351 0.02
352 0.02
353 0.02
354 0.02
355 0.02
356 0.03
357 0.03
358 0.03
359 0.05
360 0.05
361 0.06
362 0.07
363 0.07
364 0.07
365 0.07
366 0.07
367 0.06
368 0.06
369 0.06
370 0.07
371 0.07
372 0.06
373 0.07
374 0.07
375 0.08
376 0.1
377 0.09
378 0.08
379 0.08
380 0.08
381 0.08
382 0.08
383 0.07
384 0.05
385 0.05
386 0.05
387 0.05
388 0.04
389 0.04
390 0.04
391 0.03
392 0.03
393 0.02
394 0.02
395 0.02
396 0.02
397 0.02
398 0.02
399 0.02
400 0.02
401 0.02
402 0.03
403 0.03
404 0.03
405 0.04
406 0.04
407 0.03
408 0.04
409 0.04
410 0.04
411 0.04
412 0.04
413 0.04
414 0.06
415 0.08
416 0.09
417 0.12
418 0.16
419 0.18
420 0.22
421 0.28
422 0.33
423 0.38
424 0.44
425 0.46
426 0.49
427 0.49
428 0.46
429 0.42
430 0.36
431 0.3
432 0.23
433 0.18
434 0.1
435 0.08
436 0.07
437 0.05
438 0.04
439 0.04
440 0.04
441 0.04
442 0.05
443 0.04
444 0.04
445 0.04
446 0.05
447 0.05
448 0.05
449 0.04
450 0.04
451 0.04
452 0.05
453 0.04
454 0.04
455 0.04
456 0.04
457 0.04
458 0.03
459 0.03
460 0.04
461 0.04
462 0.04
463 0.04
464 0.04
465 0.04
466 0.04
467 0.04
468 0.03
469 0.04
470 0.05
471 0.05
472 0.06
473 0.06
474 0.1
475 0.11
476 0.12
477 0.12
478 0.13
479 0.14
480 0.17
481 0.2
482 0.19
483 0.2
484 0.22
485 0.21
486 0.21
487 0.21
488 0.2
489 0.19
490 0.21
491 0.19
492 0.18
493 0.18
494 0.21
495 0.2
496 0.2
497 0.21
498 0.27
499 0.29
500 0.3
501 0.33
502 0.36
503 0.42
504 0.47
505 0.49
506 0.48
507 0.52
508 0.56
509 0.55
510 0.51
511 0.46
512 0.39
513 0.33
514 0.25
515 0.18
516 0.13
517 0.1
518 0.07
519 0.08
520 0.08
521 0.09
522 0.1
523 0.11
524 0.13
525 0.14
526 0.15
527 0.15
528 0.15
529 0.15
530 0.14
531 0.13
532 0.12
533 0.12
534 0.1
535 0.1
536 0.11
537 0.12
538 0.12
539 0.11
540 0.12
541 0.1
542 0.1
543 0.14
544 0.13
545 0.12
546 0.13
547 0.14
548 0.16
549 0.16
550 0.16
551 0.13