Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K3J9

Protein Details
Accession E3K3J9    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
87-106VNEPKVYKLNPNKEKPNFHTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 10, cyto_nucl 8.5, nucl 5
Family & Domain DBs
KEGG pgr:PGTG_05012  -  
Amino Acid Sequences MAKQDSTPEENTGVALRDPAKLGRLRGKAIGAGPGALNSKPVCVYVGLGHYPKVPCGANYVTAKGTEQHDLDKLFSRGVGVLSRRTVNEPKVYKLNPNKEKPNFHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.14
5 0.15
6 0.16
7 0.19
8 0.21
9 0.25
10 0.31
11 0.33
12 0.34
13 0.35
14 0.35
15 0.32
16 0.3
17 0.29
18 0.2
19 0.17
20 0.15
21 0.14
22 0.14
23 0.12
24 0.13
25 0.09
26 0.1
27 0.09
28 0.1
29 0.09
30 0.08
31 0.09
32 0.08
33 0.11
34 0.12
35 0.12
36 0.12
37 0.14
38 0.14
39 0.13
40 0.14
41 0.11
42 0.1
43 0.14
44 0.14
45 0.17
46 0.18
47 0.2
48 0.18
49 0.18
50 0.18
51 0.16
52 0.17
53 0.15
54 0.14
55 0.14
56 0.16
57 0.17
58 0.18
59 0.2
60 0.19
61 0.16
62 0.16
63 0.14
64 0.13
65 0.13
66 0.16
67 0.14
68 0.17
69 0.19
70 0.21
71 0.22
72 0.27
73 0.31
74 0.32
75 0.39
76 0.39
77 0.41
78 0.48
79 0.49
80 0.53
81 0.58
82 0.64
83 0.65
84 0.71
85 0.76
86 0.76