Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KJH1

Protein Details
Accession E3KJH1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
111-133RLDLRKNRKGKYRIRRQRYDLSTBasic
NLS Segment(s)
PositionSequence
116-125KNRKGKYRIR
Subcellular Location(s) cyto 7, nucl 4, plas 4, golg 4, mito 3, pero 3
Family & Domain DBs
KEGG pgr:PGTG_10166  -  
Amino Acid Sequences MDEPKVEISDVIRETIQSDDPNVTIANLEKYFTEDAHLHFSIFKQPHVARGRQYLKGIYKLFRLVTINNKVEIHSVMFSQDGLLGAIECTQSGQLRLWSIKSTFKFSCILRLDLRKNRKGKYRIRRQRYDLSTEADGSRWPLPPGVGFMVDLLSCLMAWLMALLGQFLAHRGLLNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.21
4 0.15
5 0.16
6 0.16
7 0.16
8 0.17
9 0.16
10 0.13
11 0.12
12 0.12
13 0.16
14 0.14
15 0.15
16 0.13
17 0.17
18 0.18
19 0.17
20 0.18
21 0.15
22 0.16
23 0.22
24 0.22
25 0.19
26 0.19
27 0.2
28 0.25
29 0.24
30 0.23
31 0.24
32 0.24
33 0.32
34 0.37
35 0.4
36 0.35
37 0.43
38 0.48
39 0.44
40 0.46
41 0.43
42 0.41
43 0.45
44 0.44
45 0.36
46 0.33
47 0.32
48 0.31
49 0.27
50 0.26
51 0.21
52 0.26
53 0.32
54 0.31
55 0.31
56 0.31
57 0.28
58 0.28
59 0.26
60 0.19
61 0.11
62 0.1
63 0.09
64 0.08
65 0.08
66 0.07
67 0.06
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.06
81 0.07
82 0.08
83 0.09
84 0.1
85 0.12
86 0.13
87 0.18
88 0.19
89 0.24
90 0.23
91 0.24
92 0.27
93 0.25
94 0.32
95 0.29
96 0.31
97 0.29
98 0.36
99 0.42
100 0.47
101 0.55
102 0.54
103 0.58
104 0.6
105 0.66
106 0.68
107 0.7
108 0.73
109 0.76
110 0.79
111 0.83
112 0.86
113 0.83
114 0.85
115 0.79
116 0.75
117 0.67
118 0.61
119 0.53
120 0.46
121 0.39
122 0.29
123 0.24
124 0.2
125 0.19
126 0.16
127 0.15
128 0.14
129 0.15
130 0.15
131 0.18
132 0.17
133 0.15
134 0.13
135 0.13
136 0.13
137 0.12
138 0.11
139 0.08
140 0.06
141 0.05
142 0.05
143 0.05
144 0.04
145 0.04
146 0.03
147 0.03
148 0.04
149 0.04
150 0.04
151 0.05
152 0.05
153 0.05
154 0.06
155 0.08
156 0.07