Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6QSI8

Protein Details
Accession H6QSI8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-47GKHGHQSSKCRKKTNHKTKASTATTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG pgr:PGTG_21801  -  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MTLRGGDGLRSSREKQIACFNCGKHGHQSSKCRKKTNHKTKASTATTVKPGSYESSSFGDDEKFSVISK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.44
4 0.44
5 0.44
6 0.46
7 0.4
8 0.42
9 0.44
10 0.43
11 0.41
12 0.43
13 0.46
14 0.48
15 0.58
16 0.61
17 0.69
18 0.72
19 0.72
20 0.72
21 0.75
22 0.79
23 0.81
24 0.8
25 0.78
26 0.79
27 0.78
28 0.81
29 0.73
30 0.66
31 0.58
32 0.52
33 0.48
34 0.43
35 0.36
36 0.27
37 0.25
38 0.24
39 0.23
40 0.2
41 0.18
42 0.2
43 0.21
44 0.21
45 0.2
46 0.19
47 0.16
48 0.16
49 0.15