Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3L9M7

Protein Details
Accession E3L9M7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-100CENTNKKAKHVRPPMKLFDRLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG pgr:PGTG_19198  -  
Amino Acid Sequences MQSSNERFRITYGSRSASGIVGMDHIRQGPYSSFAQKFAIVKNISSYLLADQISGIVFLNKAPLFFFGGTGVLPIAHLCENTNKKAKHVRPPMKLFDRLKGRAISVKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.36
4 0.29
5 0.25
6 0.18
7 0.13
8 0.11
9 0.11
10 0.1
11 0.1
12 0.1
13 0.1
14 0.1
15 0.11
16 0.1
17 0.13
18 0.15
19 0.2
20 0.2
21 0.22
22 0.23
23 0.23
24 0.24
25 0.22
26 0.26
27 0.21
28 0.2
29 0.2
30 0.2
31 0.18
32 0.17
33 0.16
34 0.09
35 0.11
36 0.11
37 0.09
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.04
44 0.04
45 0.04
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.11
52 0.11
53 0.11
54 0.08
55 0.09
56 0.08
57 0.08
58 0.07
59 0.05
60 0.05
61 0.04
62 0.05
63 0.06
64 0.06
65 0.07
66 0.16
67 0.2
68 0.26
69 0.34
70 0.33
71 0.39
72 0.49
73 0.55
74 0.57
75 0.64
76 0.69
77 0.7
78 0.77
79 0.82
80 0.79
81 0.81
82 0.73
83 0.71
84 0.71
85 0.64
86 0.62
87 0.54
88 0.51