Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3L0J3

Protein Details
Accession E3L0J3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTIKKKKKNKKKKTTINSGSDFSHydrophilic
NLS Segment(s)
PositionSequence
4-13KKKKKNKKKK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
KEGG pgr:PGTG_15854  -  
Amino Acid Sequences MTIKKKKKNKKKKTTINSGSDFSTTSSPQLVDTPNTSTKLLPSPPVNEPTAAIGALSIIREEALAALERKGDPRYRPIEDSEFIGLDECNDSPTSTPNNPTSAPDNPILFYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.94
3 0.92
4 0.85
5 0.75
6 0.66
7 0.55
8 0.45
9 0.35
10 0.28
11 0.19
12 0.16
13 0.15
14 0.13
15 0.13
16 0.15
17 0.15
18 0.14
19 0.15
20 0.19
21 0.21
22 0.23
23 0.23
24 0.2
25 0.2
26 0.23
27 0.22
28 0.21
29 0.2
30 0.22
31 0.24
32 0.28
33 0.26
34 0.22
35 0.21
36 0.19
37 0.17
38 0.13
39 0.1
40 0.06
41 0.06
42 0.06
43 0.05
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.05
52 0.05
53 0.06
54 0.07
55 0.07
56 0.09
57 0.12
58 0.16
59 0.17
60 0.24
61 0.3
62 0.33
63 0.35
64 0.38
65 0.4
66 0.36
67 0.37
68 0.31
69 0.25
70 0.21
71 0.2
72 0.15
73 0.11
74 0.11
75 0.08
76 0.08
77 0.09
78 0.09
79 0.09
80 0.13
81 0.19
82 0.2
83 0.26
84 0.27
85 0.3
86 0.31
87 0.34
88 0.35
89 0.33
90 0.34
91 0.33
92 0.32