Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KIU8

Protein Details
Accession E3KIU8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
55-78TGAVMIKTKKQKKEIERQRLKAAEHydrophilic
299-320LVMKRMKILKYLKRTNPKSYFEHydrophilic
NLS Segment(s)
PositionSequence
63-75KKQKKEIERQRLK
Subcellular Location(s) mito 18, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000589  Ribosomal_S15  
IPR005290  Ribosomal_S15_bac-type  
IPR009068  S15_NS1_RNA-bd  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pgr:PGTG_10601  -  
Pfam View protein in Pfam  
PF00312  Ribosomal_S15  
CDD cd00677  S15_NS1_EPRS_RNA-bind  
Amino Acid Sequences MTRLIWSGFKTGLGSIKNSNQTTQLLITSRLGSLGSTGNKDHVGRVGKTECFSTTGAVMIKTKKQKKEIERQRLKAAEAKATLRTSLKLRQKPDPILGYSTQIPKAHLNWENCELNKLIVKKEDVWAGKIGPVELDDPLQPKTPIDRNNQQDKEGGASLVLNFGLNENEHQKAILFDGLPKMKELIKIKNKPIFDPSLTEPLPSDSDSIMNEQDEEDLKKLRLMRILDLRNSNSKGIDKFIKLRILKAFSPKDHLHPEKLDPGCSEVQAAMITYRIHAVLDHAWQNRRDKDSKRHLSDLVMKRMKILKYLKRTNPKSYFELLPRIGLEPRYLKDELIVRAKLPLRPGESLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.33
4 0.4
5 0.41
6 0.4
7 0.38
8 0.37
9 0.37
10 0.33
11 0.3
12 0.24
13 0.25
14 0.26
15 0.24
16 0.22
17 0.2
18 0.18
19 0.14
20 0.13
21 0.17
22 0.17
23 0.18
24 0.19
25 0.21
26 0.24
27 0.25
28 0.24
29 0.25
30 0.28
31 0.26
32 0.33
33 0.35
34 0.34
35 0.35
36 0.35
37 0.3
38 0.27
39 0.27
40 0.21
41 0.17
42 0.17
43 0.17
44 0.17
45 0.19
46 0.2
47 0.27
48 0.36
49 0.43
50 0.48
51 0.55
52 0.63
53 0.7
54 0.77
55 0.81
56 0.82
57 0.85
58 0.82
59 0.83
60 0.76
61 0.68
62 0.63
63 0.55
64 0.5
65 0.43
66 0.4
67 0.36
68 0.34
69 0.34
70 0.29
71 0.29
72 0.26
73 0.32
74 0.4
75 0.41
76 0.45
77 0.51
78 0.57
79 0.59
80 0.61
81 0.57
82 0.49
83 0.47
84 0.44
85 0.38
86 0.34
87 0.33
88 0.3
89 0.26
90 0.26
91 0.25
92 0.26
93 0.3
94 0.33
95 0.33
96 0.33
97 0.38
98 0.39
99 0.36
100 0.36
101 0.29
102 0.24
103 0.25
104 0.23
105 0.19
106 0.19
107 0.21
108 0.21
109 0.22
110 0.27
111 0.24
112 0.25
113 0.24
114 0.21
115 0.21
116 0.2
117 0.17
118 0.11
119 0.11
120 0.1
121 0.09
122 0.09
123 0.08
124 0.09
125 0.11
126 0.12
127 0.11
128 0.11
129 0.15
130 0.21
131 0.26
132 0.32
133 0.39
134 0.45
135 0.55
136 0.56
137 0.52
138 0.48
139 0.42
140 0.38
141 0.3
142 0.22
143 0.12
144 0.11
145 0.09
146 0.08
147 0.08
148 0.04
149 0.04
150 0.04
151 0.05
152 0.05
153 0.06
154 0.08
155 0.09
156 0.09
157 0.09
158 0.08
159 0.08
160 0.09
161 0.09
162 0.07
163 0.07
164 0.11
165 0.13
166 0.13
167 0.13
168 0.13
169 0.13
170 0.18
171 0.21
172 0.26
173 0.35
174 0.41
175 0.47
176 0.51
177 0.51
178 0.47
179 0.48
180 0.42
181 0.33
182 0.31
183 0.27
184 0.29
185 0.28
186 0.27
187 0.23
188 0.21
189 0.21
190 0.17
191 0.16
192 0.09
193 0.1
194 0.11
195 0.12
196 0.11
197 0.09
198 0.09
199 0.08
200 0.09
201 0.09
202 0.1
203 0.1
204 0.11
205 0.11
206 0.13
207 0.15
208 0.16
209 0.2
210 0.21
211 0.24
212 0.31
213 0.35
214 0.37
215 0.39
216 0.4
217 0.4
218 0.41
219 0.36
220 0.3
221 0.29
222 0.26
223 0.26
224 0.28
225 0.25
226 0.28
227 0.32
228 0.38
229 0.35
230 0.38
231 0.4
232 0.4
233 0.4
234 0.44
235 0.46
236 0.39
237 0.46
238 0.44
239 0.44
240 0.48
241 0.49
242 0.45
243 0.42
244 0.44
245 0.46
246 0.45
247 0.41
248 0.32
249 0.33
250 0.29
251 0.26
252 0.23
253 0.14
254 0.14
255 0.12
256 0.12
257 0.08
258 0.08
259 0.08
260 0.08
261 0.09
262 0.08
263 0.08
264 0.08
265 0.1
266 0.11
267 0.15
268 0.21
269 0.25
270 0.29
271 0.34
272 0.41
273 0.45
274 0.49
275 0.52
276 0.54
277 0.6
278 0.67
279 0.73
280 0.73
281 0.72
282 0.67
283 0.66
284 0.68
285 0.66
286 0.66
287 0.6
288 0.53
289 0.53
290 0.58
291 0.52
292 0.5
293 0.51
294 0.49
295 0.55
296 0.65
297 0.7
298 0.75
299 0.81
300 0.83
301 0.83
302 0.79
303 0.74
304 0.69
305 0.66
306 0.6
307 0.62
308 0.53
309 0.46
310 0.42
311 0.38
312 0.36
313 0.31
314 0.31
315 0.28
316 0.29
317 0.32
318 0.31
319 0.28
320 0.3
321 0.35
322 0.36
323 0.38
324 0.37
325 0.32
326 0.38
327 0.42
328 0.4
329 0.4
330 0.4
331 0.38