Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6QPB1

Protein Details
Accession H6QPB1    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
22-42NENNHPAKKKKAPNYTEPKDFHydrophilic
148-177LVKSPKWHNYCRDNNKRGEKKRARSPSSEAHydrophilic
NLS Segment(s)
PositionSequence
164-171RGEKKRAR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
KEGG pgr:PGTG_20669  -  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MARKRIQNVDPSLDDNDDKENNENNHPAKKKKAPNYTEPKDFEVCRAWVQVSEDPMVGTNQDGNTFWSCVSTLYHEAVPDPIQPVDSLKKRWSNYLQPSINKFHGFVNLVESRNESGASAEDQLNQDLRLYSQDQQSHFKYLRCYKLLVKSPKWHNYCRDNNKRGEKKRARSPSSEAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.3
3 0.3
4 0.25
5 0.24
6 0.25
7 0.29
8 0.29
9 0.33
10 0.39
11 0.38
12 0.46
13 0.5
14 0.51
15 0.54
16 0.6
17 0.65
18 0.68
19 0.75
20 0.72
21 0.77
22 0.82
23 0.8
24 0.79
25 0.72
26 0.67
27 0.6
28 0.54
29 0.47
30 0.4
31 0.35
32 0.28
33 0.26
34 0.22
35 0.2
36 0.23
37 0.23
38 0.2
39 0.19
40 0.18
41 0.16
42 0.16
43 0.15
44 0.11
45 0.09
46 0.08
47 0.07
48 0.08
49 0.08
50 0.1
51 0.12
52 0.12
53 0.12
54 0.1
55 0.1
56 0.1
57 0.1
58 0.11
59 0.12
60 0.12
61 0.13
62 0.12
63 0.13
64 0.13
65 0.13
66 0.1
67 0.1
68 0.08
69 0.08
70 0.08
71 0.1
72 0.15
73 0.17
74 0.18
75 0.21
76 0.28
77 0.28
78 0.33
79 0.37
80 0.4
81 0.44
82 0.52
83 0.52
84 0.49
85 0.52
86 0.51
87 0.49
88 0.4
89 0.34
90 0.25
91 0.24
92 0.22
93 0.18
94 0.2
95 0.21
96 0.22
97 0.21
98 0.21
99 0.19
100 0.17
101 0.17
102 0.11
103 0.08
104 0.08
105 0.09
106 0.1
107 0.1
108 0.12
109 0.12
110 0.13
111 0.13
112 0.12
113 0.12
114 0.1
115 0.1
116 0.11
117 0.13
118 0.16
119 0.21
120 0.25
121 0.27
122 0.33
123 0.34
124 0.38
125 0.38
126 0.37
127 0.4
128 0.44
129 0.49
130 0.45
131 0.47
132 0.46
133 0.53
134 0.6
135 0.61
136 0.61
137 0.62
138 0.7
139 0.76
140 0.76
141 0.73
142 0.72
143 0.73
144 0.77
145 0.79
146 0.8
147 0.78
148 0.82
149 0.86
150 0.88
151 0.87
152 0.87
153 0.87
154 0.85
155 0.89
156 0.9
157 0.85
158 0.81