Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KJ54

Protein Details
Accession E3KJ54    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-35RALYRAYRKTSRHPRPPIPRPINSQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039196  Fmc1  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0033615  P:mitochondrial proton-transporting ATP synthase complex assembly  
KEGG pgr:PGTG_10049  -  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
Amino Acid Sequences MSSLSCLANYRALYRAYRKTSRHPRPPIPRPINSQLRSLVNAGLKDQQLESVIRYLVSSNLHQELVRRYNPADDLTEPERLKATVNRVGLNMPKTMDLETPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.43
4 0.51
5 0.53
6 0.6
7 0.69
8 0.75
9 0.78
10 0.78
11 0.81
12 0.83
13 0.88
14 0.89
15 0.85
16 0.8
17 0.77
18 0.77
19 0.77
20 0.68
21 0.61
22 0.54
23 0.47
24 0.44
25 0.37
26 0.31
27 0.23
28 0.21
29 0.19
30 0.19
31 0.17
32 0.16
33 0.15
34 0.12
35 0.11
36 0.11
37 0.11
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.09
45 0.1
46 0.11
47 0.12
48 0.13
49 0.13
50 0.15
51 0.19
52 0.22
53 0.23
54 0.23
55 0.22
56 0.24
57 0.25
58 0.25
59 0.22
60 0.18
61 0.22
62 0.23
63 0.29
64 0.27
65 0.26
66 0.25
67 0.23
68 0.25
69 0.24
70 0.28
71 0.27
72 0.3
73 0.31
74 0.3
75 0.34
76 0.36
77 0.34
78 0.29
79 0.23
80 0.23
81 0.23
82 0.24