Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KC57

Protein Details
Accession E3KC57    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGKRKAAKKPNKKAKLQPLDKIFRCHydrophilic
NLS Segment(s)
PositionSequence
3-15KRKAAKKPNKKAK
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0008023  C:transcription elongation factor complex  
GO:0046872  F:metal ion binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG pgr:PGTG_08082  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAAKKPNKKAKLQPLDKIFRCLFCQHAGVVHCKLDRQEMQSRIECSKCGQHFETKIDHLTEPIDVYSLWIDAAEAANDEPPTTTHQNDSREQSSTATPRPSSKHSSSSARQQQQQQQRSHQQPEDRFDDGIDDPDGELPDDLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.87
4 0.84
5 0.83
6 0.83
7 0.76
8 0.72
9 0.63
10 0.55
11 0.51
12 0.45
13 0.38
14 0.31
15 0.31
16 0.24
17 0.26
18 0.25
19 0.26
20 0.26
21 0.26
22 0.23
23 0.23
24 0.23
25 0.25
26 0.26
27 0.28
28 0.34
29 0.35
30 0.39
31 0.42
32 0.44
33 0.41
34 0.39
35 0.33
36 0.27
37 0.31
38 0.28
39 0.29
40 0.28
41 0.31
42 0.33
43 0.36
44 0.37
45 0.31
46 0.31
47 0.27
48 0.25
49 0.19
50 0.17
51 0.14
52 0.11
53 0.09
54 0.07
55 0.05
56 0.06
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.11
73 0.13
74 0.14
75 0.17
76 0.22
77 0.26
78 0.3
79 0.34
80 0.31
81 0.31
82 0.31
83 0.29
84 0.28
85 0.28
86 0.28
87 0.27
88 0.26
89 0.28
90 0.32
91 0.35
92 0.39
93 0.39
94 0.41
95 0.42
96 0.49
97 0.49
98 0.55
99 0.6
100 0.59
101 0.6
102 0.62
103 0.66
104 0.69
105 0.74
106 0.69
107 0.68
108 0.72
109 0.74
110 0.74
111 0.71
112 0.69
113 0.67
114 0.67
115 0.64
116 0.56
117 0.48
118 0.4
119 0.38
120 0.3
121 0.26
122 0.21
123 0.16
124 0.14
125 0.16
126 0.17
127 0.13