Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6QQJ2

Protein Details
Accession H6QQJ2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
170-196GKRPITQAPVRKRQKKIPKGAAKLPEDHydrophilic
NLS Segment(s)
PositionSequence
175-191TQAPVRKRQKKIPKGAA
Subcellular Location(s) nucl 20, cyto_nucl 12.333, cyto_mito 3.666, mito 3.5
Family & Domain DBs
KEGG pgr:PGTG_21199  -  
Amino Acid Sequences MAVPYSPRVAKLAHNTRLPAQNLFPNQFKKLPSYLPNVANPQAPQYQVLKTGTSTKIVRLAHNNPQPVQNVFPHQFQATQAHLANGAHPQILQYQQARYDPNGMRYSHQTMQRIPQPGPEQYQAGPLNQVVRIGTPITNLNVLQSHPNAVQSQALYNMIQDQSKRIAQLGKRPITQAPVRKRQKKIPKGAAKLPEDLPLDRYMSDAESST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.54
4 0.6
5 0.56
6 0.48
7 0.42
8 0.42
9 0.44
10 0.46
11 0.46
12 0.43
13 0.45
14 0.45
15 0.43
16 0.41
17 0.39
18 0.41
19 0.4
20 0.43
21 0.46
22 0.46
23 0.49
24 0.49
25 0.47
26 0.43
27 0.38
28 0.34
29 0.3
30 0.26
31 0.24
32 0.22
33 0.22
34 0.24
35 0.25
36 0.21
37 0.2
38 0.26
39 0.24
40 0.27
41 0.26
42 0.23
43 0.28
44 0.29
45 0.31
46 0.32
47 0.36
48 0.41
49 0.46
50 0.47
51 0.41
52 0.43
53 0.42
54 0.36
55 0.34
56 0.26
57 0.27
58 0.27
59 0.27
60 0.25
61 0.23
62 0.22
63 0.21
64 0.22
65 0.17
66 0.18
67 0.17
68 0.16
69 0.16
70 0.15
71 0.15
72 0.12
73 0.11
74 0.08
75 0.08
76 0.08
77 0.09
78 0.1
79 0.12
80 0.12
81 0.12
82 0.14
83 0.17
84 0.17
85 0.16
86 0.22
87 0.21
88 0.25
89 0.28
90 0.27
91 0.26
92 0.28
93 0.33
94 0.3
95 0.33
96 0.29
97 0.27
98 0.31
99 0.35
100 0.34
101 0.29
102 0.3
103 0.29
104 0.29
105 0.31
106 0.28
107 0.24
108 0.21
109 0.28
110 0.23
111 0.2
112 0.19
113 0.16
114 0.17
115 0.15
116 0.15
117 0.09
118 0.08
119 0.09
120 0.09
121 0.09
122 0.09
123 0.1
124 0.1
125 0.11
126 0.11
127 0.11
128 0.11
129 0.11
130 0.13
131 0.12
132 0.14
133 0.13
134 0.15
135 0.14
136 0.14
137 0.15
138 0.13
139 0.13
140 0.12
141 0.13
142 0.11
143 0.11
144 0.14
145 0.13
146 0.14
147 0.13
148 0.15
149 0.18
150 0.19
151 0.2
152 0.19
153 0.24
154 0.26
155 0.35
156 0.42
157 0.44
158 0.44
159 0.46
160 0.45
161 0.46
162 0.5
163 0.5
164 0.5
165 0.55
166 0.64
167 0.71
168 0.76
169 0.8
170 0.84
171 0.85
172 0.86
173 0.86
174 0.86
175 0.85
176 0.86
177 0.85
178 0.77
179 0.71
180 0.62
181 0.57
182 0.5
183 0.43
184 0.38
185 0.31
186 0.29
187 0.24
188 0.24
189 0.18
190 0.17