Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3LB47

Protein Details
Accession E3LB47    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
243-264TKGPADTKKNSKATPKKKKGKKBasic
NLS Segment(s)
PositionSequence
239-264KNKGTKGPADTKKNSKATPKKKKGKK
Subcellular Location(s) nucl 16, mito 5.5, cyto_mito 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002778  Signal_recog_particle_SRP19  
IPR036521  SRP19-like_sf  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006617  P:SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition  
KEGG pgr:PGTG_19799  -  
Pfam View protein in Pfam  
PF01922  SRP19  
Amino Acid Sequences MSRIYELSADDVDDFDFPLEASSSNMPGSSSGPSGSSNMPGMPPNIPGFSNMLAGMMGAGMGPQPPIKKEVDRSRTKNWETIYPRYLDSKAPCKTGGRRVALKYSLRWPLAQLIQHACTQIGLPCQLENDKVHPADWENPGRVKVLIKRNNKPIDPSIPNKYALLCKIGLLLRPLETVRLNLPPPTAKDRNSTPLPNINLRLPYNSPAVSHGFLAMAEAEAQKPTESSGPAIEDAPGSKNKGTKGPADTKKNSKATPKKKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.08
4 0.07
5 0.07
6 0.08
7 0.07
8 0.1
9 0.11
10 0.12
11 0.12
12 0.13
13 0.12
14 0.12
15 0.14
16 0.13
17 0.13
18 0.12
19 0.13
20 0.14
21 0.16
22 0.16
23 0.17
24 0.15
25 0.15
26 0.16
27 0.16
28 0.17
29 0.16
30 0.18
31 0.17
32 0.18
33 0.17
34 0.17
35 0.18
36 0.18
37 0.17
38 0.14
39 0.12
40 0.11
41 0.1
42 0.09
43 0.05
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.06
51 0.08
52 0.09
53 0.12
54 0.15
55 0.19
56 0.28
57 0.38
58 0.46
59 0.54
60 0.59
61 0.65
62 0.72
63 0.7
64 0.66
65 0.57
66 0.57
67 0.53
68 0.54
69 0.48
70 0.4
71 0.39
72 0.38
73 0.37
74 0.32
75 0.31
76 0.34
77 0.33
78 0.33
79 0.34
80 0.35
81 0.39
82 0.43
83 0.47
84 0.43
85 0.46
86 0.46
87 0.49
88 0.51
89 0.47
90 0.41
91 0.39
92 0.4
93 0.35
94 0.33
95 0.29
96 0.27
97 0.28
98 0.27
99 0.24
100 0.2
101 0.21
102 0.22
103 0.21
104 0.17
105 0.14
106 0.12
107 0.11
108 0.1
109 0.09
110 0.08
111 0.08
112 0.09
113 0.09
114 0.11
115 0.1
116 0.12
117 0.14
118 0.14
119 0.14
120 0.14
121 0.15
122 0.17
123 0.21
124 0.21
125 0.19
126 0.2
127 0.21
128 0.21
129 0.2
130 0.18
131 0.21
132 0.28
133 0.36
134 0.43
135 0.48
136 0.57
137 0.61
138 0.6
139 0.57
140 0.51
141 0.5
142 0.47
143 0.46
144 0.43
145 0.4
146 0.4
147 0.36
148 0.34
149 0.28
150 0.24
151 0.22
152 0.16
153 0.14
154 0.16
155 0.17
156 0.17
157 0.15
158 0.15
159 0.13
160 0.14
161 0.14
162 0.13
163 0.13
164 0.13
165 0.13
166 0.16
167 0.16
168 0.16
169 0.18
170 0.19
171 0.22
172 0.29
173 0.31
174 0.3
175 0.34
176 0.37
177 0.42
178 0.44
179 0.43
180 0.39
181 0.42
182 0.44
183 0.44
184 0.42
185 0.38
186 0.38
187 0.36
188 0.36
189 0.31
190 0.3
191 0.29
192 0.27
193 0.24
194 0.22
195 0.25
196 0.21
197 0.19
198 0.17
199 0.14
200 0.13
201 0.13
202 0.1
203 0.07
204 0.07
205 0.07
206 0.07
207 0.08
208 0.09
209 0.08
210 0.08
211 0.1
212 0.12
213 0.12
214 0.13
215 0.15
216 0.17
217 0.17
218 0.18
219 0.17
220 0.14
221 0.15
222 0.17
223 0.18
224 0.19
225 0.2
226 0.24
227 0.26
228 0.32
229 0.34
230 0.37
231 0.43
232 0.5
233 0.57
234 0.64
235 0.69
236 0.71
237 0.77
238 0.78
239 0.74
240 0.75
241 0.77
242 0.78
243 0.82
244 0.84