Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K0U3

Protein Details
Accession E3K0U3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
3-29ACKPRGLHAARKLRNQRRDNRWADKSYHydrophilic
NLS Segment(s)
PositionSequence
12-23ARKLRNQRRDNR
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005680  Ribosomal_S23_euk/arc  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pgr:PGTG_03874  -  
pgr:PGTG_20458  -  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03367  Ribosomal_S23  
Amino Acid Sequences MGACKPRGLHAARKLRNQRRDNRWADKSYKKRALGTAYRSSPTGGSSHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFLDDNDEVLVAGFGRAGKAKGDIPGVRFKVVKVSGVGLLALWLEKKEKPRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.84
4 0.84
5 0.84
6 0.83
7 0.87
8 0.86
9 0.85
10 0.83
11 0.79
12 0.77
13 0.78
14 0.77
15 0.77
16 0.77
17 0.7
18 0.66
19 0.64
20 0.65
21 0.62
22 0.6
23 0.58
24 0.53
25 0.5
26 0.47
27 0.43
28 0.34
29 0.27
30 0.21
31 0.15
32 0.15
33 0.15
34 0.16
35 0.17
36 0.17
37 0.15
38 0.16
39 0.15
40 0.13
41 0.12
42 0.1
43 0.1
44 0.11
45 0.1
46 0.1
47 0.12
48 0.12
49 0.15
50 0.15
51 0.17
52 0.22
53 0.23
54 0.27
55 0.25
56 0.29
57 0.27
58 0.32
59 0.34
60 0.33
61 0.34
62 0.4
63 0.48
64 0.48
65 0.52
66 0.48
67 0.44
68 0.39
69 0.38
70 0.31
71 0.3
72 0.25
73 0.24
74 0.25
75 0.25
76 0.25
77 0.24
78 0.22
79 0.12
80 0.15
81 0.12
82 0.1
83 0.12
84 0.11
85 0.11
86 0.11
87 0.1
88 0.07
89 0.07
90 0.07
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.06
97 0.07
98 0.07
99 0.1
100 0.11
101 0.13
102 0.19
103 0.21
104 0.23
105 0.32
106 0.33
107 0.33
108 0.32
109 0.3
110 0.33
111 0.32
112 0.31
113 0.24
114 0.24
115 0.23
116 0.23
117 0.22
118 0.13
119 0.12
120 0.1
121 0.09
122 0.07
123 0.07
124 0.1
125 0.14