Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KQF6

Protein Details
Accession E3KQF6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-34TDASQPQTKQKRGPNWLPREEEQHydrophilic
NLS Segment(s)
PositionSequence
196-201KAAKKR
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
KEGG pgr:PGTG_12487  -  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MATPSTPVEETTDASQPQTKQKRGPNWLPREEEQLAISWINISEQPEFATNQSGKTFYRKIEKDFNTHSKANYRNHAQIKTRWTAMNTATLKFSAIYNAIERNPPSGSSPDDWLEAAKMNYLDQTKGTAFSNLPAWQKLRYAPKWRADPRVDQPATPLPTTLSDSIDPESAHDENPGMSSPTVRSASSISRPIGGKAAKKRRIEGYQHEELLSQTSDLAVISQERLTAFHKGNEILINKNNIMKEKIEIERKKLQLEQEKLAVEKEYRQSETDMNDFKILRDAEDLGDEEAKDVIKIIKDQIKNKWRARAGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.28
4 0.37
5 0.45
6 0.48
7 0.51
8 0.6
9 0.68
10 0.73
11 0.8
12 0.8
13 0.8
14 0.83
15 0.81
16 0.74
17 0.72
18 0.64
19 0.54
20 0.44
21 0.36
22 0.3
23 0.23
24 0.21
25 0.13
26 0.12
27 0.11
28 0.12
29 0.13
30 0.12
31 0.12
32 0.14
33 0.15
34 0.16
35 0.15
36 0.21
37 0.19
38 0.21
39 0.22
40 0.23
41 0.22
42 0.28
43 0.31
44 0.28
45 0.38
46 0.39
47 0.43
48 0.51
49 0.54
50 0.55
51 0.6
52 0.63
53 0.6
54 0.58
55 0.55
56 0.52
57 0.56
58 0.54
59 0.54
60 0.51
61 0.53
62 0.58
63 0.62
64 0.59
65 0.58
66 0.59
67 0.55
68 0.52
69 0.45
70 0.4
71 0.38
72 0.34
73 0.37
74 0.32
75 0.29
76 0.27
77 0.25
78 0.24
79 0.2
80 0.18
81 0.11
82 0.11
83 0.11
84 0.12
85 0.14
86 0.15
87 0.17
88 0.18
89 0.18
90 0.17
91 0.16
92 0.17
93 0.16
94 0.18
95 0.17
96 0.19
97 0.18
98 0.18
99 0.18
100 0.16
101 0.15
102 0.13
103 0.11
104 0.1
105 0.09
106 0.08
107 0.11
108 0.12
109 0.12
110 0.1
111 0.13
112 0.12
113 0.13
114 0.13
115 0.12
116 0.11
117 0.12
118 0.15
119 0.16
120 0.17
121 0.17
122 0.18
123 0.17
124 0.19
125 0.23
126 0.28
127 0.31
128 0.38
129 0.43
130 0.48
131 0.57
132 0.6
133 0.63
134 0.57
135 0.57
136 0.54
137 0.57
138 0.51
139 0.42
140 0.4
141 0.38
142 0.37
143 0.3
144 0.26
145 0.16
146 0.16
147 0.19
148 0.17
149 0.13
150 0.11
151 0.12
152 0.13
153 0.13
154 0.12
155 0.1
156 0.12
157 0.11
158 0.11
159 0.1
160 0.1
161 0.08
162 0.09
163 0.09
164 0.07
165 0.06
166 0.07
167 0.07
168 0.12
169 0.13
170 0.12
171 0.13
172 0.14
173 0.17
174 0.2
175 0.24
176 0.2
177 0.22
178 0.22
179 0.22
180 0.25
181 0.25
182 0.27
183 0.33
184 0.44
185 0.48
186 0.5
187 0.53
188 0.55
189 0.6
190 0.6
191 0.6
192 0.57
193 0.54
194 0.53
195 0.5
196 0.43
197 0.35
198 0.31
199 0.22
200 0.14
201 0.08
202 0.07
203 0.07
204 0.06
205 0.06
206 0.04
207 0.05
208 0.06
209 0.06
210 0.07
211 0.07
212 0.09
213 0.11
214 0.16
215 0.17
216 0.18
217 0.21
218 0.2
219 0.22
220 0.25
221 0.25
222 0.24
223 0.26
224 0.27
225 0.26
226 0.29
227 0.29
228 0.27
229 0.28
230 0.24
231 0.23
232 0.26
233 0.31
234 0.38
235 0.4
236 0.44
237 0.5
238 0.52
239 0.53
240 0.5
241 0.52
242 0.52
243 0.54
244 0.52
245 0.48
246 0.47
247 0.44
248 0.41
249 0.35
250 0.26
251 0.27
252 0.3
253 0.3
254 0.31
255 0.32
256 0.33
257 0.34
258 0.37
259 0.38
260 0.35
261 0.32
262 0.34
263 0.33
264 0.3
265 0.34
266 0.29
267 0.24
268 0.22
269 0.22
270 0.18
271 0.2
272 0.21
273 0.16
274 0.17
275 0.16
276 0.14
277 0.14
278 0.13
279 0.11
280 0.11
281 0.12
282 0.13
283 0.15
284 0.22
285 0.29
286 0.36
287 0.43
288 0.52
289 0.59
290 0.67
291 0.71
292 0.74