Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KDI6

Protein Details
Accession E3KDI6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
100-128VKNWCTSATKKESKKRKRATPNNSGQQVDHydrophilic
NLS Segment(s)
PositionSequence
109-117KKESKKRKR
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
KEGG pgr:PGTG_08378  -  
Amino Acid Sequences MRQIRKTMQTSLVNSNCIKSGLNCQHNCDRGGCTITPTEEVMIERRRSTVKRSEVIHNDDDNYVINSASLSAQVSHRKISGLNFAALQPLDWINALHDGVKNWCTSATKKESKKRKRATPNNSGQQVDPRLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.36
4 0.3
5 0.27
6 0.18
7 0.26
8 0.31
9 0.4
10 0.41
11 0.45
12 0.52
13 0.54
14 0.54
15 0.45
16 0.38
17 0.31
18 0.33
19 0.28
20 0.23
21 0.21
22 0.21
23 0.2
24 0.18
25 0.16
26 0.13
27 0.13
28 0.16
29 0.2
30 0.2
31 0.19
32 0.21
33 0.25
34 0.25
35 0.3
36 0.34
37 0.35
38 0.39
39 0.42
40 0.47
41 0.49
42 0.52
43 0.5
44 0.42
45 0.37
46 0.31
47 0.28
48 0.21
49 0.16
50 0.11
51 0.07
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.04
58 0.05
59 0.08
60 0.13
61 0.14
62 0.14
63 0.15
64 0.15
65 0.16
66 0.17
67 0.21
68 0.19
69 0.18
70 0.18
71 0.18
72 0.19
73 0.17
74 0.16
75 0.09
76 0.08
77 0.08
78 0.07
79 0.07
80 0.07
81 0.09
82 0.09
83 0.09
84 0.1
85 0.11
86 0.13
87 0.15
88 0.14
89 0.13
90 0.15
91 0.16
92 0.18
93 0.26
94 0.33
95 0.4
96 0.5
97 0.59
98 0.68
99 0.76
100 0.84
101 0.86
102 0.87
103 0.89
104 0.91
105 0.92
106 0.92
107 0.92
108 0.91
109 0.86
110 0.77
111 0.68
112 0.65