Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2H9P2

Protein Details
Accession Q2H9P2   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VAAKKHIPIVKKRTKRFMRHQSDRFKCVDHydrophilic
NLS Segment(s)
PositionSequence
11-17VKKRTKR
35-38KPKG
42-42R
44-45RR
Subcellular Location(s) mito 19, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHIPIVKKRTKRFMRHQSDRFKCVDAAWRKPKGIDNRVRRRFRGTLAMPSIGYGSNKKTRHMMPSGHKAFLVSNVQDVELLLMHNKTYAAEIAHNVSSRKRVDIIARAKQLGVKVTNAKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.83
3 0.86
4 0.87
5 0.87
6 0.88
7 0.88
8 0.89
9 0.9
10 0.86
11 0.81
12 0.72
13 0.64
14 0.53
15 0.45
16 0.45
17 0.42
18 0.45
19 0.49
20 0.51
21 0.49
22 0.51
23 0.56
24 0.56
25 0.59
26 0.58
27 0.6
28 0.67
29 0.77
30 0.79
31 0.74
32 0.71
33 0.64
34 0.58
35 0.56
36 0.48
37 0.46
38 0.43
39 0.42
40 0.35
41 0.32
42 0.29
43 0.2
44 0.18
45 0.12
46 0.13
47 0.2
48 0.21
49 0.21
50 0.25
51 0.26
52 0.31
53 0.33
54 0.35
55 0.34
56 0.44
57 0.45
58 0.42
59 0.39
60 0.35
61 0.31
62 0.28
63 0.25
64 0.15
65 0.13
66 0.13
67 0.13
68 0.13
69 0.12
70 0.09
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.08
82 0.09
83 0.1
84 0.13
85 0.15
86 0.16
87 0.16
88 0.17
89 0.22
90 0.22
91 0.23
92 0.22
93 0.23
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37