Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KFL4

Protein Details
Accession E3KFL4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-39LWVSMKRETGKKKPYKYIPKNSWRKRGEWHydrophilic
NLS Segment(s)
PositionSequence
20-35GKKKPYKYIPKNSWRK
Subcellular Location(s) nucl 20.5, mito_nucl 13.333, cyto_nucl 12.166, mito 4
Family & Domain DBs
KEGG pgr:PGTG_09031  -  
Amino Acid Sequences MMKRNGNLWSLWVSMKRETGKKKPYKYIPKNSWRKRGEWSCRSPGIPELDQGQESGEATTRLPAHTTGERLESFSQNPNDRNGIDRERFGYEVQGLASPLIYVCVTSELEKPNSELIHNRVEQAEFVWNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.35
4 0.4
5 0.47
6 0.54
7 0.6
8 0.67
9 0.72
10 0.76
11 0.8
12 0.84
13 0.86
14 0.87
15 0.87
16 0.88
17 0.91
18 0.91
19 0.9
20 0.82
21 0.75
22 0.74
23 0.74
24 0.74
25 0.72
26 0.7
27 0.66
28 0.66
29 0.63
30 0.55
31 0.48
32 0.43
33 0.34
34 0.28
35 0.24
36 0.22
37 0.21
38 0.2
39 0.16
40 0.1
41 0.1
42 0.09
43 0.07
44 0.06
45 0.06
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.11
52 0.12
53 0.14
54 0.12
55 0.14
56 0.14
57 0.16
58 0.17
59 0.16
60 0.16
61 0.2
62 0.24
63 0.24
64 0.25
65 0.26
66 0.26
67 0.25
68 0.26
69 0.25
70 0.27
71 0.25
72 0.26
73 0.26
74 0.26
75 0.27
76 0.25
77 0.22
78 0.16
79 0.15
80 0.15
81 0.13
82 0.11
83 0.09
84 0.09
85 0.07
86 0.06
87 0.07
88 0.06
89 0.05
90 0.05
91 0.08
92 0.09
93 0.11
94 0.15
95 0.18
96 0.21
97 0.21
98 0.22
99 0.24
100 0.24
101 0.24
102 0.26
103 0.25
104 0.32
105 0.32
106 0.32
107 0.3
108 0.3
109 0.28
110 0.25