Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3LAS2

Protein Details
Accession E3LAS2   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
250-272DDNSYRSKIKKNIRATSKNDSDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 14.833, cyto 9, cyto_mito 6.165
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0006457  P:protein folding  
KEGG pgr:PGTG_19596  -  
Amino Acid Sequences MPALRYSEDTEFNDALRARGILPQLPADPESPEATSPEEPRPEDLIDELDNQKAIDELELDEDIPAHLVDSWKSARLAELQHAKQTTNARSSGLRPIGKEDYVREVNQASEVDVDPNSAHTRRGTGVVLCLWNNSSASKHILSLLEQISHQYPSTHFLSIPGESCIANYPDANQPTLICYRAGACLRQYVGIGSSSEISKTNGKLSAGLSTRLDDLEAELLSIGALDEHLKVKSSSEKYPDGNSRLEDDDDNSYRSKIKKNIRATSKNDSDSELDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.22
4 0.2
5 0.15
6 0.18
7 0.21
8 0.19
9 0.2
10 0.23
11 0.23
12 0.24
13 0.25
14 0.22
15 0.21
16 0.2
17 0.2
18 0.18
19 0.17
20 0.16
21 0.19
22 0.22
23 0.23
24 0.27
25 0.3
26 0.3
27 0.33
28 0.35
29 0.31
30 0.28
31 0.26
32 0.23
33 0.19
34 0.22
35 0.2
36 0.17
37 0.17
38 0.16
39 0.15
40 0.12
41 0.11
42 0.08
43 0.07
44 0.07
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.08
51 0.08
52 0.07
53 0.05
54 0.06
55 0.06
56 0.07
57 0.11
58 0.12
59 0.14
60 0.14
61 0.14
62 0.14
63 0.17
64 0.19
65 0.21
66 0.29
67 0.28
68 0.32
69 0.33
70 0.32
71 0.33
72 0.37
73 0.35
74 0.3
75 0.29
76 0.27
77 0.28
78 0.3
79 0.33
80 0.33
81 0.31
82 0.27
83 0.32
84 0.33
85 0.33
86 0.32
87 0.26
88 0.26
89 0.27
90 0.27
91 0.23
92 0.2
93 0.19
94 0.2
95 0.18
96 0.11
97 0.1
98 0.1
99 0.1
100 0.09
101 0.09
102 0.07
103 0.09
104 0.11
105 0.1
106 0.11
107 0.1
108 0.12
109 0.12
110 0.14
111 0.14
112 0.11
113 0.12
114 0.13
115 0.14
116 0.12
117 0.12
118 0.1
119 0.1
120 0.1
121 0.09
122 0.08
123 0.08
124 0.11
125 0.11
126 0.11
127 0.12
128 0.12
129 0.12
130 0.15
131 0.14
132 0.12
133 0.11
134 0.12
135 0.12
136 0.12
137 0.11
138 0.08
139 0.08
140 0.12
141 0.14
142 0.13
143 0.12
144 0.13
145 0.15
146 0.15
147 0.15
148 0.12
149 0.11
150 0.1
151 0.11
152 0.11
153 0.1
154 0.1
155 0.09
156 0.11
157 0.15
158 0.17
159 0.17
160 0.15
161 0.14
162 0.16
163 0.18
164 0.17
165 0.11
166 0.1
167 0.11
168 0.16
169 0.17
170 0.16
171 0.15
172 0.17
173 0.18
174 0.18
175 0.17
176 0.13
177 0.13
178 0.12
179 0.12
180 0.09
181 0.1
182 0.09
183 0.1
184 0.1
185 0.11
186 0.14
187 0.15
188 0.17
189 0.19
190 0.19
191 0.2
192 0.2
193 0.25
194 0.23
195 0.24
196 0.22
197 0.2
198 0.21
199 0.19
200 0.18
201 0.11
202 0.1
203 0.1
204 0.09
205 0.08
206 0.07
207 0.07
208 0.06
209 0.06
210 0.05
211 0.03
212 0.03
213 0.04
214 0.05
215 0.07
216 0.08
217 0.1
218 0.1
219 0.13
220 0.22
221 0.25
222 0.3
223 0.34
224 0.39
225 0.41
226 0.49
227 0.54
228 0.49
229 0.48
230 0.43
231 0.41
232 0.39
233 0.38
234 0.32
235 0.27
236 0.31
237 0.29
238 0.3
239 0.27
240 0.26
241 0.28
242 0.32
243 0.37
244 0.39
245 0.47
246 0.55
247 0.64
248 0.73
249 0.79
250 0.83
251 0.82
252 0.83
253 0.82
254 0.77
255 0.68
256 0.61