Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6QQ06

Protein Details
Accession H6QQ06    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-61WHPRLYPKSNGRRDPRRTYLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 2, cyto 2
Family & Domain DBs
KEGG pgr:PGTG_20952  -  
Amino Acid Sequences MPQKRGAEDQEPINVDSGSDIESVKAPFKAKSTRTSKKSWVWHPRLYPKSNGRRDPRRTYLPERLACRRHDQCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.17
4 0.15
5 0.1
6 0.08
7 0.08
8 0.07
9 0.09
10 0.1
11 0.11
12 0.13
13 0.13
14 0.14
15 0.18
16 0.24
17 0.25
18 0.34
19 0.42
20 0.49
21 0.52
22 0.55
23 0.58
24 0.58
25 0.63
26 0.64
27 0.65
28 0.63
29 0.65
30 0.67
31 0.7
32 0.7
33 0.66
34 0.64
35 0.63
36 0.67
37 0.7
38 0.72
39 0.71
40 0.74
41 0.79
42 0.81
43 0.78
44 0.77
45 0.76
46 0.76
47 0.77
48 0.76
49 0.74
50 0.72
51 0.73
52 0.7
53 0.66
54 0.67