Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KJL2

Protein Details
Accession E3KJL2   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
98-124HFPSPPKKNLMKFKRNKPGKKQSSSSTHydrophilic
NLS Segment(s)
PositionSequence
99-118FPSPPKKNLMKFKRNKPGKK
Subcellular Location(s) nucl 23, mito_nucl 13.833, cyto_nucl 12.333
Family & Domain DBs
KEGG pgr:PGTG_10207  -  
Amino Acid Sequences MTTIIRKETPATSQDKETSKEKQPLNKEKSSAMEIDEIDPECSEVTPTRPSTPEIRILSKEDQVKLRESQKALQKLINNEEIESYVKGWNPWEEKKIHFPSPPKKNLMKFKRNKPGKKQSSSSTNFSDPAKWKKVTDLLQMASGLYQNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.44
4 0.44
5 0.45
6 0.47
7 0.52
8 0.52
9 0.55
10 0.61
11 0.68
12 0.71
13 0.7
14 0.64
15 0.59
16 0.57
17 0.52
18 0.42
19 0.33
20 0.29
21 0.24
22 0.23
23 0.22
24 0.19
25 0.16
26 0.15
27 0.13
28 0.1
29 0.09
30 0.09
31 0.08
32 0.1
33 0.15
34 0.17
35 0.19
36 0.2
37 0.22
38 0.25
39 0.27
40 0.33
41 0.31
42 0.32
43 0.32
44 0.35
45 0.35
46 0.35
47 0.36
48 0.3
49 0.31
50 0.29
51 0.3
52 0.3
53 0.32
54 0.31
55 0.29
56 0.32
57 0.35
58 0.39
59 0.37
60 0.37
61 0.35
62 0.34
63 0.36
64 0.35
65 0.28
66 0.23
67 0.22
68 0.2
69 0.18
70 0.15
71 0.13
72 0.1
73 0.1
74 0.1
75 0.11
76 0.15
77 0.18
78 0.21
79 0.23
80 0.25
81 0.27
82 0.36
83 0.4
84 0.4
85 0.41
86 0.46
87 0.52
88 0.6
89 0.64
90 0.61
91 0.62
92 0.66
93 0.72
94 0.74
95 0.75
96 0.74
97 0.78
98 0.82
99 0.86
100 0.88
101 0.88
102 0.89
103 0.88
104 0.87
105 0.82
106 0.79
107 0.79
108 0.75
109 0.69
110 0.63
111 0.56
112 0.5
113 0.45
114 0.45
115 0.41
116 0.45
117 0.46
118 0.43
119 0.42
120 0.46
121 0.53
122 0.51
123 0.53
124 0.52
125 0.46
126 0.46
127 0.45
128 0.39
129 0.32