Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3L733

Protein Details
Accession E3L733   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-65KEIVKKAKTQTKPSKKAAGKHydrophilic
85-107DAEPKPPPKKKTKVDKAPVKEESBasic
NLS Segment(s)
PositionSequence
39-64KTVKPNGKEIVKKAKTQTKPSKKAAG
89-104KPPPKKKTKVDKAPVK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.333, mito_nucl 12.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR000866  AhpC/TSA  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0008379  F:thioredoxin peroxidase activity  
GO:0045454  P:cell redox homeostasis  
GO:0034599  P:cellular response to oxidative stress  
KEGG pgr:PGTG_18343  -  
Pfam View protein in Pfam  
PF00578  AhpC-TSA  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
CDD cd03017  PRX_BCP  
Amino Acid Sequences MPKKRSSTEPGSEVAPRRSTRVSAKPLPAGNQNPRTTGKTVKPNGKEIVKKAKTQTKPSKKAAGKAEDDSLSELSAESQVKELEDAEPKPPPKKKTKVDKAPVKEESTSSSKKKLAIGEKLPETIILKNHDDADVNVLELTAEKGLIIFIYPKSNTPGCTTQACGYRDLHKEIVDAGFQVVGLSMDSPKAQTTWKVKQKLPYTLLCDPEQQLIKLLGSSKTQTSVQRSHFIFEAGGKLIQVDPKATTTTSPKQALEFIRSLANQTTAEETS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.39
4 0.41
5 0.42
6 0.44
7 0.46
8 0.51
9 0.54
10 0.55
11 0.59
12 0.61
13 0.61
14 0.6
15 0.6
16 0.58
17 0.59
18 0.6
19 0.56
20 0.54
21 0.55
22 0.55
23 0.5
24 0.49
25 0.47
26 0.49
27 0.55
28 0.6
29 0.61
30 0.62
31 0.66
32 0.66
33 0.64
34 0.61
35 0.64
36 0.59
37 0.6
38 0.61
39 0.65
40 0.64
41 0.69
42 0.73
43 0.73
44 0.78
45 0.79
46 0.81
47 0.75
48 0.75
49 0.73
50 0.7
51 0.62
52 0.56
53 0.54
54 0.44
55 0.41
56 0.36
57 0.27
58 0.19
59 0.15
60 0.12
61 0.09
62 0.11
63 0.11
64 0.09
65 0.1
66 0.1
67 0.1
68 0.1
69 0.11
70 0.1
71 0.14
72 0.15
73 0.16
74 0.2
75 0.23
76 0.3
77 0.35
78 0.4
79 0.46
80 0.54
81 0.62
82 0.68
83 0.77
84 0.8
85 0.84
86 0.87
87 0.83
88 0.82
89 0.77
90 0.68
91 0.58
92 0.48
93 0.42
94 0.39
95 0.37
96 0.31
97 0.32
98 0.31
99 0.32
100 0.34
101 0.36
102 0.36
103 0.38
104 0.41
105 0.41
106 0.4
107 0.38
108 0.35
109 0.29
110 0.24
111 0.19
112 0.17
113 0.15
114 0.15
115 0.15
116 0.16
117 0.16
118 0.15
119 0.13
120 0.13
121 0.1
122 0.09
123 0.08
124 0.07
125 0.06
126 0.06
127 0.06
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.05
137 0.08
138 0.09
139 0.1
140 0.14
141 0.15
142 0.16
143 0.19
144 0.22
145 0.21
146 0.22
147 0.24
148 0.24
149 0.3
150 0.3
151 0.27
152 0.26
153 0.3
154 0.32
155 0.34
156 0.31
157 0.25
158 0.24
159 0.23
160 0.22
161 0.15
162 0.13
163 0.09
164 0.07
165 0.07
166 0.06
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.05
173 0.05
174 0.06
175 0.06
176 0.07
177 0.08
178 0.15
179 0.22
180 0.32
181 0.41
182 0.47
183 0.49
184 0.57
185 0.63
186 0.65
187 0.62
188 0.57
189 0.56
190 0.54
191 0.55
192 0.48
193 0.44
194 0.36
195 0.37
196 0.33
197 0.26
198 0.23
199 0.21
200 0.2
201 0.18
202 0.19
203 0.16
204 0.17
205 0.18
206 0.17
207 0.19
208 0.23
209 0.27
210 0.31
211 0.37
212 0.39
213 0.44
214 0.44
215 0.43
216 0.41
217 0.36
218 0.3
219 0.24
220 0.23
221 0.17
222 0.16
223 0.13
224 0.14
225 0.14
226 0.16
227 0.16
228 0.14
229 0.14
230 0.16
231 0.18
232 0.18
233 0.2
234 0.25
235 0.32
236 0.38
237 0.41
238 0.39
239 0.39
240 0.45
241 0.46
242 0.44
243 0.38
244 0.32
245 0.32
246 0.32
247 0.33
248 0.29
249 0.28
250 0.22
251 0.22