Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3KF74

Protein Details
Accession E3KF74    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-75GRRINEEKKGRAKVQKNRKRBasic
NLS Segment(s)
PositionSequence
57-75RRINEEKKGRAKVQKNRKR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
KEGG pgr:PGTG_09869  -  
Amino Acid Sequences MGFLIMLVIQQSIIVKRSIASAIIQRTRGEGGMASNGRVANKGHRKGSLVSCGEAGRRINEEKKGRAKVQKNRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.12
5 0.12
6 0.11
7 0.12
8 0.15
9 0.21
10 0.24
11 0.26
12 0.24
13 0.24
14 0.24
15 0.23
16 0.18
17 0.12
18 0.09
19 0.14
20 0.14
21 0.12
22 0.13
23 0.14
24 0.13
25 0.14
26 0.14
27 0.17
28 0.26
29 0.3
30 0.31
31 0.32
32 0.34
33 0.37
34 0.41
35 0.4
36 0.33
37 0.29
38 0.29
39 0.28
40 0.26
41 0.26
42 0.23
43 0.16
44 0.19
45 0.23
46 0.26
47 0.35
48 0.41
49 0.46
50 0.54
51 0.59
52 0.63
53 0.68
54 0.74
55 0.75