Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KYP7

Protein Details
Accession E3KYP7   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-45FAYVSKRKPRHSHSKKPKNGDLEBasic
NLS Segment(s)
PositionSequence
28-40KRKPRHSHSKKPK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 9
Family & Domain DBs
KEGG pgr:PGTG_15285  -  
Amino Acid Sequences MVRQAAKPLDVSLDPRVQEFEGFAYVSKRKPRHSHSKKPKNGDLEARSMAKLFLEYSFPVFECNSKVSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.25
4 0.22
5 0.21
6 0.17
7 0.14
8 0.11
9 0.1
10 0.1
11 0.12
12 0.14
13 0.18
14 0.25
15 0.27
16 0.33
17 0.4
18 0.47
19 0.56
20 0.64
21 0.71
22 0.74
23 0.82
24 0.82
25 0.83
26 0.81
27 0.75
28 0.7
29 0.67
30 0.59
31 0.53
32 0.49
33 0.43
34 0.37
35 0.31
36 0.27
37 0.18
38 0.15
39 0.11
40 0.09
41 0.1
42 0.11
43 0.13
44 0.14
45 0.14
46 0.15
47 0.15
48 0.16
49 0.17