Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JTV6

Protein Details
Accession E3JTV6    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
139-161HPNSTNQNRNRNRNRNANRQNHAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
KEGG pgr:PGTG_00784  -  
Amino Acid Sequences MKVVAISKASELQDDLADKINPQDFKDLFGNWDPKAECEEYLTGPTGRKYKRSKDIPVTPTPDPEMQIDPPAEVPPLHQGTSQQYQQAYYNQHSYPYPQSYQQLPQEGQFFNQASPYYPQPVASTAPAPYPHVPTSEVHPNSTNQNRNRNRNRNANRQNHAHRAPNNFRPMSANGPRQRTNSQTARENRRVAYQRSIHQEMIRLSRTTQAQYQALEAMREQSAGYGNRRQPQEGGANQNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.18
5 0.17
6 0.21
7 0.25
8 0.24
9 0.24
10 0.31
11 0.27
12 0.31
13 0.34
14 0.3
15 0.29
16 0.34
17 0.37
18 0.29
19 0.34
20 0.3
21 0.28
22 0.33
23 0.3
24 0.23
25 0.23
26 0.25
27 0.2
28 0.22
29 0.23
30 0.19
31 0.2
32 0.23
33 0.28
34 0.28
35 0.36
36 0.42
37 0.49
38 0.58
39 0.64
40 0.7
41 0.72
42 0.79
43 0.77
44 0.77
45 0.73
46 0.64
47 0.58
48 0.52
49 0.43
50 0.34
51 0.3
52 0.25
53 0.2
54 0.23
55 0.2
56 0.17
57 0.17
58 0.16
59 0.14
60 0.11
61 0.11
62 0.15
63 0.17
64 0.17
65 0.16
66 0.17
67 0.22
68 0.27
69 0.28
70 0.24
71 0.22
72 0.22
73 0.24
74 0.27
75 0.25
76 0.22
77 0.26
78 0.23
79 0.24
80 0.23
81 0.25
82 0.25
83 0.26
84 0.25
85 0.23
86 0.25
87 0.26
88 0.31
89 0.31
90 0.3
91 0.27
92 0.27
93 0.29
94 0.26
95 0.24
96 0.22
97 0.19
98 0.15
99 0.16
100 0.14
101 0.12
102 0.14
103 0.14
104 0.14
105 0.13
106 0.14
107 0.13
108 0.14
109 0.14
110 0.13
111 0.13
112 0.1
113 0.12
114 0.12
115 0.14
116 0.14
117 0.16
118 0.16
119 0.16
120 0.17
121 0.16
122 0.2
123 0.27
124 0.26
125 0.24
126 0.25
127 0.25
128 0.3
129 0.37
130 0.4
131 0.36
132 0.46
133 0.53
134 0.62
135 0.72
136 0.75
137 0.75
138 0.78
139 0.81
140 0.82
141 0.84
142 0.83
143 0.78
144 0.77
145 0.76
146 0.74
147 0.7
148 0.66
149 0.61
150 0.61
151 0.62
152 0.61
153 0.62
154 0.53
155 0.5
156 0.47
157 0.44
158 0.43
159 0.44
160 0.46
161 0.43
162 0.5
163 0.53
164 0.53
165 0.54
166 0.5
167 0.51
168 0.49
169 0.49
170 0.52
171 0.57
172 0.62
173 0.66
174 0.64
175 0.57
176 0.6
177 0.61
178 0.56
179 0.57
180 0.53
181 0.52
182 0.57
183 0.6
184 0.53
185 0.48
186 0.49
187 0.44
188 0.45
189 0.42
190 0.34
191 0.31
192 0.34
193 0.35
194 0.33
195 0.33
196 0.32
197 0.31
198 0.31
199 0.32
200 0.3
201 0.28
202 0.26
203 0.22
204 0.19
205 0.17
206 0.16
207 0.15
208 0.12
209 0.16
210 0.19
211 0.24
212 0.3
213 0.36
214 0.43
215 0.45
216 0.46
217 0.42
218 0.45
219 0.49
220 0.47