Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K327

Protein Details
Accession E3K327    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-33TPDARNARTQSSRRQRPRKTYLEQRARMYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
KEGG pgr:PGTG_04840  -  
Amino Acid Sequences MKMITPDARNARTQSSRRQRPRKTYLEQRARMYYQATHPALVGPRHPHAPPARHPRTLTIIIRGALPVLRGLGTPARPTLGTQEILRRPSVEKYVDEEERKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.66
4 0.73
5 0.81
6 0.83
7 0.85
8 0.9
9 0.88
10 0.86
11 0.86
12 0.86
13 0.86
14 0.82
15 0.76
16 0.72
17 0.64
18 0.56
19 0.47
20 0.39
21 0.32
22 0.35
23 0.31
24 0.26
25 0.24
26 0.25
27 0.25
28 0.23
29 0.22
30 0.16
31 0.17
32 0.2
33 0.2
34 0.23
35 0.25
36 0.29
37 0.35
38 0.43
39 0.46
40 0.47
41 0.47
42 0.45
43 0.46
44 0.47
45 0.4
46 0.33
47 0.3
48 0.27
49 0.27
50 0.23
51 0.18
52 0.12
53 0.11
54 0.07
55 0.06
56 0.06
57 0.05
58 0.07
59 0.11
60 0.12
61 0.13
62 0.13
63 0.14
64 0.14
65 0.15
66 0.18
67 0.19
68 0.19
69 0.2
70 0.28
71 0.32
72 0.34
73 0.34
74 0.31
75 0.29
76 0.32
77 0.37
78 0.32
79 0.29
80 0.33
81 0.4
82 0.45