Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K211

Protein Details
Accession E3K211   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
197-216DGKPSKWWMCFQKRKFMGKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.333, cyto_mito 5.166, mito 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007204  ARPC3  
IPR036753  ARPC3_sf  
Gene Ontology GO:0030479  C:actin cortical patch  
GO:0005885  C:Arp2/3 protein complex  
GO:0005739  C:mitochondrion  
GO:0051015  F:actin filament binding  
GO:0044396  P:actin cortical patch organization  
GO:0034314  P:Arp2/3 complex-mediated actin nucleation  
GO:0006897  P:endocytosis  
GO:0051654  P:establishment of mitochondrion localization  
GO:0071963  P:establishment or maintenance of cell polarity regulating cell shape  
GO:0030833  P:regulation of actin filament polymerization  
KEGG pgr:PGTG_04336  -  
Pfam View protein in Pfam  
PF04062  P21-Arc  
Amino Acid Sequences MGDVEGWLFITRSTASSSSELLNQQQAQQPPPPPPLSMPAYHSAYNHATDYRPVANMVILPIRSKIRGPAPPLANPSDMDIVDEALDLFKSNSLFRNFEIKGFADRVLIYLILFISDCLHRISLLKPHQNNKNEASKQLLSYSLDNFFLPGEPGFPMNGIYAPPKDKIDADLLKQYLTQIRQECSLRLIEKVYNTPDGKPSKWWMCFQKRKFMGKSLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.19
4 0.21
5 0.2
6 0.23
7 0.24
8 0.22
9 0.27
10 0.24
11 0.27
12 0.31
13 0.32
14 0.32
15 0.36
16 0.37
17 0.37
18 0.42
19 0.4
20 0.36
21 0.35
22 0.37
23 0.36
24 0.34
25 0.33
26 0.32
27 0.34
28 0.34
29 0.32
30 0.31
31 0.29
32 0.28
33 0.26
34 0.21
35 0.18
36 0.19
37 0.22
38 0.19
39 0.17
40 0.16
41 0.15
42 0.14
43 0.13
44 0.14
45 0.13
46 0.11
47 0.11
48 0.13
49 0.15
50 0.15
51 0.15
52 0.18
53 0.22
54 0.27
55 0.31
56 0.36
57 0.38
58 0.41
59 0.44
60 0.42
61 0.36
62 0.31
63 0.29
64 0.23
65 0.19
66 0.16
67 0.13
68 0.1
69 0.09
70 0.09
71 0.06
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.06
78 0.07
79 0.11
80 0.14
81 0.15
82 0.16
83 0.24
84 0.23
85 0.23
86 0.24
87 0.2
88 0.2
89 0.2
90 0.19
91 0.12
92 0.12
93 0.12
94 0.1
95 0.09
96 0.07
97 0.06
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.06
105 0.06
106 0.06
107 0.06
108 0.08
109 0.09
110 0.16
111 0.23
112 0.29
113 0.33
114 0.4
115 0.48
116 0.51
117 0.53
118 0.5
119 0.53
120 0.47
121 0.44
122 0.44
123 0.37
124 0.34
125 0.31
126 0.28
127 0.2
128 0.2
129 0.21
130 0.16
131 0.16
132 0.14
133 0.14
134 0.12
135 0.1
136 0.1
137 0.08
138 0.07
139 0.07
140 0.08
141 0.08
142 0.07
143 0.08
144 0.07
145 0.08
146 0.08
147 0.1
148 0.12
149 0.14
150 0.16
151 0.17
152 0.18
153 0.18
154 0.19
155 0.25
156 0.26
157 0.26
158 0.31
159 0.3
160 0.29
161 0.29
162 0.28
163 0.25
164 0.24
165 0.27
166 0.25
167 0.26
168 0.31
169 0.33
170 0.32
171 0.29
172 0.33
173 0.27
174 0.25
175 0.27
176 0.24
177 0.26
178 0.3
179 0.31
180 0.34
181 0.34
182 0.34
183 0.39
184 0.42
185 0.4
186 0.4
187 0.46
188 0.47
189 0.5
190 0.56
191 0.58
192 0.64
193 0.74
194 0.73
195 0.76
196 0.75
197 0.8
198 0.77