Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KKP9

Protein Details
Accession E3KKP9    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
147-168ALPRRRRQQTHVRLGRHRRAFDBasic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 10.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016567  P:protein ubiquitination  
KEGG pgr:PGTG_10345  -  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MTRFLRKMMEVFLTLFQNRQRDRLDARENSYLLRDLPQIRLILQASEESDAQLLTALIDHWISLIHAFSNARRSQRVQDLLDQMKNPPARSARRAPSECPICMEILSNIRHSNVRAPCHLTHVFHRNCLQEWLEGELNCPMCRAPFALPRRRRQQTHVRLGRHRRAFDLLVLLCWGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.27
4 0.33
5 0.32
6 0.36
7 0.36
8 0.37
9 0.42
10 0.48
11 0.54
12 0.51
13 0.55
14 0.55
15 0.52
16 0.48
17 0.45
18 0.36
19 0.28
20 0.24
21 0.23
22 0.2
23 0.22
24 0.24
25 0.22
26 0.21
27 0.24
28 0.22
29 0.18
30 0.16
31 0.15
32 0.13
33 0.14
34 0.13
35 0.09
36 0.09
37 0.08
38 0.07
39 0.07
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.06
54 0.06
55 0.08
56 0.14
57 0.17
58 0.19
59 0.21
60 0.24
61 0.27
62 0.34
63 0.38
64 0.33
65 0.35
66 0.39
67 0.4
68 0.39
69 0.35
70 0.28
71 0.28
72 0.28
73 0.23
74 0.2
75 0.22
76 0.24
77 0.29
78 0.36
79 0.37
80 0.44
81 0.46
82 0.44
83 0.47
84 0.48
85 0.42
86 0.38
87 0.32
88 0.24
89 0.22
90 0.21
91 0.14
92 0.15
93 0.16
94 0.15
95 0.14
96 0.15
97 0.16
98 0.16
99 0.23
100 0.23
101 0.25
102 0.26
103 0.31
104 0.31
105 0.36
106 0.38
107 0.32
108 0.33
109 0.4
110 0.38
111 0.37
112 0.4
113 0.36
114 0.35
115 0.36
116 0.31
117 0.24
118 0.24
119 0.25
120 0.24
121 0.22
122 0.21
123 0.22
124 0.22
125 0.2
126 0.19
127 0.14
128 0.12
129 0.13
130 0.14
131 0.15
132 0.23
133 0.32
134 0.42
135 0.5
136 0.59
137 0.68
138 0.75
139 0.74
140 0.74
141 0.76
142 0.77
143 0.8
144 0.79
145 0.77
146 0.79
147 0.85
148 0.86
149 0.84
150 0.75
151 0.68
152 0.65
153 0.58
154 0.51
155 0.49
156 0.39
157 0.32