Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KK20

Protein Details
Accession E3KK20    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-101IDKSLKEKKLKPKSASIKAQIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 5, cyto 3, extr 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
KEGG pgr:PGTG_10804  -  
Amino Acid Sequences MYASYFKMWLLLISPLRLIGRSNCAFPSTEETLELAFKDYDFLLKSRKLSTELSYGDEEYFSWLETGQKISGKHSQDEENIDKSLKEKKLKPKSASIKAQIWNFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.18
4 0.18
5 0.18
6 0.15
7 0.22
8 0.22
9 0.24
10 0.23
11 0.24
12 0.24
13 0.24
14 0.28
15 0.23
16 0.22
17 0.2
18 0.2
19 0.19
20 0.19
21 0.17
22 0.12
23 0.08
24 0.08
25 0.08
26 0.07
27 0.08
28 0.09
29 0.1
30 0.12
31 0.14
32 0.16
33 0.17
34 0.18
35 0.2
36 0.21
37 0.22
38 0.24
39 0.23
40 0.24
41 0.23
42 0.22
43 0.19
44 0.17
45 0.14
46 0.11
47 0.1
48 0.07
49 0.07
50 0.06
51 0.07
52 0.08
53 0.1
54 0.09
55 0.13
56 0.13
57 0.17
58 0.23
59 0.25
60 0.26
61 0.28
62 0.3
63 0.29
64 0.36
65 0.35
66 0.31
67 0.3
68 0.28
69 0.25
70 0.24
71 0.3
72 0.31
73 0.35
74 0.4
75 0.5
76 0.61
77 0.7
78 0.73
79 0.76
80 0.79
81 0.81
82 0.83
83 0.79
84 0.75
85 0.72