Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KSE4

Protein Details
Accession E3KSE4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSKNHTNHNQNKKAHKNGIHRPLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG pgr:PGTG_12814  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHKNGIHRPLRCRYPSLKGVDPKFRRNQKFAKHGTQKALAAARAEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.8
4 0.78
5 0.76
6 0.77
7 0.8
8 0.79
9 0.73
10 0.7
11 0.69
12 0.68
13 0.6
14 0.55
15 0.48
16 0.46
17 0.49
18 0.47
19 0.47
20 0.45
21 0.48
22 0.54
23 0.54
24 0.55
25 0.58
26 0.63
27 0.63
28 0.64
29 0.68
30 0.67
31 0.72
32 0.72
33 0.73
34 0.73
35 0.73
36 0.72
37 0.69
38 0.6
39 0.56
40 0.52
41 0.43
42 0.37